Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M9JID5

Protein Details
Accession A0A5M9JID5    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
71-103IGIHRAPRILRRRRRRLARRRLRRLLPRPLAPWBasic
NLS Segment(s)
PositionSequence
75-98RAPRILRRRRRRLARRRLRRLLPR
Subcellular Location(s) nucl 13, mito 11, cyto 1, plas 1, pero 1, cyto_pero 1
Family & Domain DBs
Amino Acid Sequences MTDQTPPQQQRETPMANIGQRRAVLPVIALEQGYGWRFTGFRIPLVLNPVRAPLPPPAPPIQPILPILANIGIHRAPRILRRRRRRLARRRLRRLLPRPLAPWVSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.4
3 0.39
4 0.42
5 0.37
6 0.33
7 0.29
8 0.29
9 0.26
10 0.22
11 0.17
12 0.14
13 0.13
14 0.11
15 0.11
16 0.1
17 0.08
18 0.08
19 0.09
20 0.1
21 0.09
22 0.07
23 0.08
24 0.08
25 0.09
26 0.15
27 0.14
28 0.14
29 0.16
30 0.16
31 0.17
32 0.23
33 0.23
34 0.17
35 0.16
36 0.17
37 0.15
38 0.15
39 0.15
40 0.13
41 0.15
42 0.16
43 0.19
44 0.2
45 0.2
46 0.22
47 0.23
48 0.21
49 0.2
50 0.19
51 0.18
52 0.15
53 0.14
54 0.13
55 0.11
56 0.1
57 0.08
58 0.1
59 0.09
60 0.09
61 0.1
62 0.11
63 0.12
64 0.2
65 0.31
66 0.39
67 0.49
68 0.6
69 0.7
70 0.79
71 0.89
72 0.91
73 0.92
74 0.93
75 0.94
76 0.94
77 0.94
78 0.94
79 0.93
80 0.93
81 0.91
82 0.91
83 0.88
84 0.84
85 0.76
86 0.74