Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9JT64

Protein Details
Accession A0A5M9JT64    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
141-166SSTPRAKPPNRASPREKTRRRCVNTSHydrophilic
NLS Segment(s)
PositionSequence
147-158KPPNRASPREKT
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR029066  PLP-binding_barrel  
IPR011078  PyrdxlP_homeostasis  
Gene Ontology GO:0030170  F:pyridoxal phosphate binding  
PROSITE View protein in PROSITE  
PS01211  UPF0001  
Amino Acid Sequences MKLTCDPNRAKSLISAFQSVSERVSNAAGTKNVRLVAVSKLKPATDILALHEQAQVEHFGENYAQELMEKAEILPGSIKWHFIGGLQSNKCKPLASTIPNLYLVSSIDSQKKAAQLSLGRSLLAMPASSTSPPSPSTSTFSSTPRAKPPNRASPREKTRRRCVNTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.37
3 0.31
4 0.34
5 0.35
6 0.31
7 0.27
8 0.21
9 0.19
10 0.17
11 0.18
12 0.14
13 0.13
14 0.16
15 0.17
16 0.19
17 0.2
18 0.21
19 0.21
20 0.2
21 0.19
22 0.18
23 0.22
24 0.28
25 0.27
26 0.28
27 0.29
28 0.29
29 0.29
30 0.28
31 0.23
32 0.17
33 0.17
34 0.17
35 0.21
36 0.21
37 0.21
38 0.21
39 0.19
40 0.16
41 0.16
42 0.13
43 0.09
44 0.09
45 0.08
46 0.07
47 0.07
48 0.07
49 0.07
50 0.06
51 0.05
52 0.05
53 0.05
54 0.06
55 0.06
56 0.06
57 0.05
58 0.06
59 0.06
60 0.07
61 0.07
62 0.06
63 0.1
64 0.1
65 0.11
66 0.09
67 0.1
68 0.09
69 0.09
70 0.12
71 0.12
72 0.19
73 0.2
74 0.22
75 0.23
76 0.24
77 0.24
78 0.21
79 0.17
80 0.17
81 0.23
82 0.24
83 0.28
84 0.29
85 0.31
86 0.32
87 0.31
88 0.25
89 0.18
90 0.15
91 0.12
92 0.11
93 0.12
94 0.14
95 0.15
96 0.16
97 0.17
98 0.2
99 0.18
100 0.17
101 0.19
102 0.19
103 0.23
104 0.28
105 0.27
106 0.24
107 0.23
108 0.23
109 0.2
110 0.17
111 0.12
112 0.06
113 0.07
114 0.09
115 0.09
116 0.11
117 0.11
118 0.12
119 0.14
120 0.18
121 0.19
122 0.21
123 0.25
124 0.26
125 0.29
126 0.3
127 0.31
128 0.35
129 0.37
130 0.39
131 0.44
132 0.51
133 0.51
134 0.59
135 0.66
136 0.7
137 0.73
138 0.77
139 0.75
140 0.77
141 0.84
142 0.84
143 0.85
144 0.83
145 0.85
146 0.88