Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9JW87

Protein Details
Accession A0A5M9JW87    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
44-66IKASGKRGPNRRRKVRILQQKGLHydrophilic
NLS Segment(s)
PositionSequence
47-59SGKRGPNRRRKVR
Subcellular Location(s) mito 15.5, cyto_mito 10, cyto 3.5, extr 3, E.R. 3
Family & Domain DBs
Amino Acid Sequences MPVDKAIRKASVTVSVLRLRGSRKALSKCCSVVVARMLGIITLIKASGKRGPNRRRKVRILQQKGLTAIGLAIKDSVLSFSLCNKANTAVSRRFSFP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.32
4 0.31
5 0.31
6 0.27
7 0.3
8 0.32
9 0.33
10 0.37
11 0.45
12 0.51
13 0.52
14 0.53
15 0.48
16 0.45
17 0.41
18 0.34
19 0.28
20 0.23
21 0.2
22 0.15
23 0.14
24 0.13
25 0.1
26 0.1
27 0.07
28 0.04
29 0.03
30 0.03
31 0.04
32 0.04
33 0.06
34 0.12
35 0.17
36 0.23
37 0.33
38 0.44
39 0.54
40 0.64
41 0.73
42 0.75
43 0.78
44 0.82
45 0.82
46 0.83
47 0.82
48 0.79
49 0.72
50 0.67
51 0.61
52 0.5
53 0.4
54 0.29
55 0.2
56 0.15
57 0.1
58 0.08
59 0.07
60 0.06
61 0.06
62 0.06
63 0.07
64 0.06
65 0.07
66 0.07
67 0.11
68 0.17
69 0.19
70 0.2
71 0.2
72 0.22
73 0.26
74 0.31
75 0.35
76 0.37
77 0.4