Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M9JCL1

Protein Details
Accession A0A5M9JCL1    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
18-40DMKGEGRLRRLRRKVQMRCKEGABasic
NLS Segment(s)
PositionSequence
26-31RRLRRK
Subcellular Location(s) mito 18, nucl 8
Family & Domain DBs
Amino Acid Sequences MHSIFRRIEYLSLLVFHDMKGEGRLRRLRRKVQMRCKEGAKKFPQLNPEFTQTGLFFPSLSFPILSRAIAFLSISTNRERSDQMVSNGIKSNRIKSIWSSSNIKQEEKNKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.14
4 0.14
5 0.12
6 0.12
7 0.15
8 0.19
9 0.19
10 0.27
11 0.35
12 0.42
13 0.52
14 0.6
15 0.65
16 0.7
17 0.79
18 0.82
19 0.84
20 0.87
21 0.82
22 0.78
23 0.77
24 0.76
25 0.7
26 0.69
27 0.63
28 0.61
29 0.6
30 0.58
31 0.59
32 0.53
33 0.53
34 0.46
35 0.45
36 0.37
37 0.33
38 0.31
39 0.22
40 0.2
41 0.15
42 0.12
43 0.08
44 0.07
45 0.08
46 0.07
47 0.08
48 0.07
49 0.06
50 0.1
51 0.11
52 0.11
53 0.1
54 0.09
55 0.09
56 0.09
57 0.09
58 0.06
59 0.08
60 0.09
61 0.11
62 0.12
63 0.14
64 0.15
65 0.17
66 0.17
67 0.17
68 0.22
69 0.25
70 0.25
71 0.31
72 0.31
73 0.32
74 0.36
75 0.34
76 0.35
77 0.33
78 0.35
79 0.33
80 0.34
81 0.34
82 0.33
83 0.42
84 0.41
85 0.45
86 0.46
87 0.46
88 0.54
89 0.55
90 0.53
91 0.51