Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9JTD7

Protein Details
Accession A0A5M9JTD7    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
64-86HVPICLSQPKRKVKNQSHAPKSKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 10, cyto_nucl 10
Family & Domain DBs
Amino Acid Sequences MILMPKPFIHPRFPKLESHSVCLLQNPRPPKPLSALKKSENHPSSLIPSSQPTFQISNHHSQSHVPICLSQPKRKVKNQSHAPKSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.55
3 0.63
4 0.56
5 0.54
6 0.51
7 0.45
8 0.42
9 0.4
10 0.37
11 0.32
12 0.34
13 0.35
14 0.35
15 0.38
16 0.39
17 0.36
18 0.38
19 0.43
20 0.45
21 0.48
22 0.5
23 0.51
24 0.55
25 0.56
26 0.59
27 0.5
28 0.45
29 0.38
30 0.33
31 0.32
32 0.27
33 0.26
34 0.16
35 0.17
36 0.17
37 0.16
38 0.16
39 0.15
40 0.15
41 0.16
42 0.22
43 0.24
44 0.3
45 0.32
46 0.31
47 0.29
48 0.29
49 0.35
50 0.32
51 0.3
52 0.23
53 0.22
54 0.24
55 0.34
56 0.38
57 0.39
58 0.43
59 0.52
60 0.6
61 0.67
62 0.75
63 0.76
64 0.81
65 0.85
66 0.87