Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9K403

Protein Details
Accession A0A5M9K403   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
21-59LDIPTKREKKRRPLIWRTGIKTTKPSKHHPRQAPCRVCLHydrophilic
NLS Segment(s)
PositionSequence
26-48KREKKRRPLIWRTGIKTTKPSKH
Subcellular Location(s) cyto_nucl 10.5, mito 7, nucl 18.5
Family & Domain DBs
Amino Acid Sequences MCLYLSYQIGVDKWSKPSIHLDIPTKREKKRRPLIWRTGIKTTKPSKHHPRQAPCRVCLNSHPSLSAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.23
4 0.29
5 0.32
6 0.34
7 0.36
8 0.4
9 0.42
10 0.47
11 0.54
12 0.53
13 0.54
14 0.59
15 0.62
16 0.66
17 0.7
18 0.74
19 0.76
20 0.8
21 0.83
22 0.83
23 0.82
24 0.75
25 0.74
26 0.67
27 0.59
28 0.57
29 0.55
30 0.54
31 0.52
32 0.58
33 0.61
34 0.68
35 0.76
36 0.78
37 0.8
38 0.83
39 0.89
40 0.86
41 0.79
42 0.77
43 0.7
44 0.63
45 0.6
46 0.56
47 0.51
48 0.45