Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H1W243

Protein Details
Accession H1W243    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
73-94DEPNPKPAKKAKKPAAGKKEAPBasic
NLS Segment(s)
PositionSequence
33-99KTKTSGAAVKNKKSANSTASPKVAGDRKRKAEEPKPELADDEPNPKPAKKAKKPAAGKKEAPPKKTK
Subcellular Location(s) nucl 16.5, cyto_nucl 11, mito 6, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MPAVTRSLRSSTRLSTTTTTTTASDERKPAPQKTKTSGAAVKNKKSANSTASPKVAGDRKRKAEEPKPELADDEPNPKPAKKAKKPAAGKKEAPPKKTKDELAALRDAPVPDVNPDAEPRDPPGPRYWX
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.35
3 0.37
4 0.36
5 0.33
6 0.3
7 0.24
8 0.26
9 0.26
10 0.27
11 0.27
12 0.28
13 0.29
14 0.35
15 0.41
16 0.45
17 0.5
18 0.55
19 0.58
20 0.6
21 0.65
22 0.59
23 0.59
24 0.58
25 0.56
26 0.58
27 0.58
28 0.57
29 0.55
30 0.54
31 0.5
32 0.47
33 0.42
34 0.38
35 0.37
36 0.38
37 0.36
38 0.36
39 0.34
40 0.31
41 0.31
42 0.32
43 0.34
44 0.36
45 0.39
46 0.44
47 0.48
48 0.52
49 0.55
50 0.58
51 0.6
52 0.57
53 0.56
54 0.52
55 0.48
56 0.45
57 0.38
58 0.35
59 0.26
60 0.27
61 0.22
62 0.23
63 0.24
64 0.24
65 0.26
66 0.3
67 0.39
68 0.42
69 0.52
70 0.58
71 0.67
72 0.76
73 0.82
74 0.85
75 0.81
76 0.77
77 0.74
78 0.76
79 0.72
80 0.68
81 0.65
82 0.62
83 0.62
84 0.64
85 0.59
86 0.54
87 0.57
88 0.58
89 0.55
90 0.53
91 0.45
92 0.4
93 0.4
94 0.34
95 0.27
96 0.22
97 0.18
98 0.16
99 0.18
100 0.17
101 0.16
102 0.18
103 0.2
104 0.2
105 0.21
106 0.24
107 0.3
108 0.3