Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H1VZI9

Protein Details
Accession H1VZI9    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-27GCRRRGGRRAAHPRHLPPHRRRVRPAEBasic
NLS Segment(s)
PositionSequence
3-45RRRGGRRAAHPRHLPPHRRRVRPAEGLQRGRPAALGEPRRRGR
Subcellular Location(s) nucl 15, mito 8, cyto 4
Family & Domain DBs
Amino Acid Sequences GCRRRGGRRAAHPRHLPPHRRRVRPAEGLQRGRPAALGEPRRRGRGAGCFYAPRAAATGAVHQPAAAETKEEVVCPTSPGQDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.82
4 0.79
5 0.82
6 0.82
7 0.81
8 0.8
9 0.79
10 0.78
11 0.77
12 0.76
13 0.75
14 0.75
15 0.72
16 0.67
17 0.62
18 0.53
19 0.44
20 0.36
21 0.26
22 0.21
23 0.23
24 0.29
25 0.29
26 0.37
27 0.39
28 0.41
29 0.4
30 0.37
31 0.33
32 0.34
33 0.35
34 0.3
35 0.3
36 0.29
37 0.29
38 0.31
39 0.28
40 0.19
41 0.15
42 0.12
43 0.12
44 0.12
45 0.15
46 0.15
47 0.15
48 0.15
49 0.13
50 0.13
51 0.12
52 0.14
53 0.1
54 0.09
55 0.09
56 0.14
57 0.15
58 0.15
59 0.15
60 0.15
61 0.16
62 0.17
63 0.19