Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M9JLG8

Protein Details
Accession A0A5M9JLG8    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
20-46GFPCQNSLRKKRGKVKIPNPTRNKQKSHydrophilic
NLS Segment(s)
PositionSequence
28-45RKKRGKVKIPNPTRNKQK
Subcellular Location(s) nucl 18.5, mito_nucl 12.166, cyto_nucl 11.833, mito 4.5
Family & Domain DBs
Amino Acid Sequences MWSAMSMMLDRWHMHVELIGFPCQNSLRKKRGKVKIPNPTRNKQKSLKYRMSSMNPQSMKFWCRMDYSFLSTSSKNALLQEFALVMNCHKNPIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.15
4 0.18
5 0.2
6 0.2
7 0.17
8 0.17
9 0.19
10 0.2
11 0.24
12 0.27
13 0.33
14 0.41
15 0.49
16 0.58
17 0.66
18 0.73
19 0.77
20 0.8
21 0.82
22 0.83
23 0.86
24 0.87
25 0.84
26 0.83
27 0.83
28 0.79
29 0.75
30 0.71
31 0.7
32 0.7
33 0.72
34 0.73
35 0.64
36 0.63
37 0.62
38 0.6
39 0.59
40 0.52
41 0.52
42 0.44
43 0.43
44 0.4
45 0.37
46 0.33
47 0.28
48 0.27
49 0.2
50 0.22
51 0.23
52 0.27
53 0.26
54 0.31
55 0.3
56 0.29
57 0.3
58 0.27
59 0.27
60 0.25
61 0.23
62 0.19
63 0.19
64 0.18
65 0.17
66 0.17
67 0.17
68 0.14
69 0.12
70 0.13
71 0.12
72 0.12
73 0.18
74 0.18