Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9JFB7

Protein Details
Accession A0A5M9JFB7    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-49RYSRILALARSKSRKRKREKGKGKGKAKGKGKAKEKGKAKEKPKKNESBasic
NLS Segment(s)
PositionSequence
11-46RSKSRKRKREKGKGKGKAKGKGKAKEKGKAKEKPKK
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MRYSRILALARSKSRKRKREKGKGKGKAKGKGKAKEKGKAKEKPKKNESLEAITYCLEHKDKDKDYSFHPFLTYRPNIHIQFHIDSSTPLPYPSKQTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.81
3 0.82
4 0.85
5 0.87
6 0.9
7 0.92
8 0.92
9 0.92
10 0.93
11 0.91
12 0.89
13 0.85
14 0.83
15 0.8
16 0.78
17 0.75
18 0.74
19 0.73
20 0.73
21 0.72
22 0.71
23 0.72
24 0.72
25 0.72
26 0.72
27 0.75
28 0.76
29 0.79
30 0.81
31 0.79
32 0.79
33 0.73
34 0.71
35 0.64
36 0.6
37 0.52
38 0.43
39 0.37
40 0.27
41 0.24
42 0.17
43 0.16
44 0.11
45 0.1
46 0.14
47 0.2
48 0.23
49 0.3
50 0.34
51 0.33
52 0.37
53 0.45
54 0.43
55 0.36
56 0.35
57 0.29
58 0.27
59 0.34
60 0.33
61 0.26
62 0.28
63 0.35
64 0.35
65 0.37
66 0.39
67 0.35
68 0.34
69 0.33
70 0.3
71 0.24
72 0.23
73 0.22
74 0.22
75 0.18
76 0.17
77 0.19
78 0.19