Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H1VI60

Protein Details
Accession H1VI60    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
120-150APSAAPSKTKNKTKTKTKNRTRTRGRGEYGNHydrophilic
NLS Segment(s)
PositionSequence
128-148KTKNKTKTKTKNRTRTRGRGE
Subcellular Location(s) mito 11, nucl 10.5, cyto_nucl 7.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences RTQCLQNPPPHPPPPPPPSVPAAPSAAPTSEPAASSAPAASASASAPSGAPAPIFETLSGPAFTPTASAPAAPTSDAASEPSSVPAASVSAPSGAPAPIFETVPXTPATTVSGAKPELTTAPSAAPSKTKNKTKTKTKNRTRTRGRGEYGNGPRPTNGPRPGGQKCSTRTTVKTIYVTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.64
3 0.58
4 0.54
5 0.53
6 0.53
7 0.47
8 0.41
9 0.37
10 0.31
11 0.29
12 0.27
13 0.22
14 0.19
15 0.18
16 0.17
17 0.15
18 0.15
19 0.15
20 0.14
21 0.14
22 0.14
23 0.12
24 0.1
25 0.09
26 0.09
27 0.07
28 0.06
29 0.06
30 0.07
31 0.07
32 0.07
33 0.06
34 0.07
35 0.07
36 0.07
37 0.07
38 0.06
39 0.08
40 0.09
41 0.09
42 0.09
43 0.09
44 0.1
45 0.12
46 0.12
47 0.1
48 0.09
49 0.09
50 0.08
51 0.08
52 0.07
53 0.08
54 0.08
55 0.07
56 0.07
57 0.08
58 0.09
59 0.08
60 0.08
61 0.07
62 0.07
63 0.08
64 0.09
65 0.08
66 0.09
67 0.09
68 0.09
69 0.08
70 0.08
71 0.07
72 0.06
73 0.06
74 0.05
75 0.05
76 0.05
77 0.05
78 0.05
79 0.05
80 0.06
81 0.05
82 0.05
83 0.05
84 0.07
85 0.07
86 0.07
87 0.07
88 0.08
89 0.09
90 0.1
91 0.1
92 0.09
93 0.08
94 0.09
95 0.09
96 0.09
97 0.09
98 0.1
99 0.1
100 0.1
101 0.1
102 0.11
103 0.11
104 0.11
105 0.11
106 0.09
107 0.09
108 0.12
109 0.13
110 0.13
111 0.16
112 0.19
113 0.27
114 0.35
115 0.42
116 0.49
117 0.59
118 0.68
119 0.75
120 0.83
121 0.85
122 0.88
123 0.91
124 0.92
125 0.92
126 0.93
127 0.92
128 0.92
129 0.9
130 0.88
131 0.81
132 0.77
133 0.72
134 0.71
135 0.7
136 0.68
137 0.61
138 0.52
139 0.5
140 0.46
141 0.47
142 0.46
143 0.43
144 0.38
145 0.41
146 0.49
147 0.54
148 0.58
149 0.57
150 0.56
151 0.55
152 0.58
153 0.6
154 0.57
155 0.54
156 0.55
157 0.57
158 0.55