Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9JM17

Protein Details
Accession A0A5M9JM17    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
4-29APSQLSSMPRPKHKKQKTGHGPQSCHHydrophilic
49-69IGVRRGPRKKLQQEKCFRGLKBasic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 12, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MHIAPSQLSSMPRPKHKKQKTGHGPQSCHPCILSAFSITPQSVELYDWIGVRRGPRKKLQQEKCFRGLKPLGRMCCDVTDAYSIMRLLASAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.69
3 0.76
4 0.81
5 0.8
6 0.84
7 0.85
8 0.87
9 0.88
10 0.85
11 0.78
12 0.74
13 0.76
14 0.66
15 0.55
16 0.44
17 0.35
18 0.27
19 0.26
20 0.22
21 0.13
22 0.12
23 0.12
24 0.14
25 0.12
26 0.12
27 0.09
28 0.09
29 0.08
30 0.08
31 0.07
32 0.07
33 0.08
34 0.08
35 0.08
36 0.08
37 0.09
38 0.12
39 0.2
40 0.25
41 0.29
42 0.36
43 0.46
44 0.56
45 0.66
46 0.73
47 0.75
48 0.8
49 0.82
50 0.82
51 0.77
52 0.67
53 0.65
54 0.61
55 0.57
56 0.57
57 0.57
58 0.53
59 0.51
60 0.53
61 0.47
62 0.42
63 0.37
64 0.28
65 0.23
66 0.22
67 0.18
68 0.16
69 0.16
70 0.14
71 0.12
72 0.12