Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9JHD7

Protein Details
Accession A0A5M9JHD7    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
92-112VHSPVDKKHHRMRRLGRCVYFBasic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 10, mito 7, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR001806  Small_GTPase  
IPR020849  Small_GTPase_Ras-type  
Gene Ontology GO:0016020  C:membrane  
GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
GO:0007165  P:signal transduction  
Pfam View protein in Pfam  
PF00071  Ras  
PROSITE View protein in PROSITE  
PS51419  RAB  
PS51421  RAS  
Amino Acid Sequences MATRNSRRDYHIVVLGADTAGTEQFTAMSDLEQDRVVSRQTAFNVSQSWGNAPYYETSARRRANVDEVFIDLCRQIIRRDNNRSTPELDDEVHSPVDKKHHRMRRLGRCVYFMIAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.29
3 0.23
4 0.17
5 0.11
6 0.06
7 0.05
8 0.05
9 0.05
10 0.04
11 0.04
12 0.05
13 0.07
14 0.06
15 0.06
16 0.08
17 0.09
18 0.1
19 0.1
20 0.1
21 0.09
22 0.1
23 0.11
24 0.11
25 0.11
26 0.13
27 0.14
28 0.18
29 0.18
30 0.19
31 0.19
32 0.18
33 0.19
34 0.16
35 0.16
36 0.13
37 0.12
38 0.11
39 0.1
40 0.1
41 0.11
42 0.13
43 0.14
44 0.17
45 0.24
46 0.25
47 0.26
48 0.27
49 0.26
50 0.32
51 0.31
52 0.28
53 0.21
54 0.22
55 0.21
56 0.19
57 0.17
58 0.09
59 0.09
60 0.08
61 0.08
62 0.09
63 0.17
64 0.25
65 0.34
66 0.44
67 0.5
68 0.57
69 0.6
70 0.61
71 0.56
72 0.51
73 0.46
74 0.39
75 0.33
76 0.27
77 0.24
78 0.24
79 0.21
80 0.18
81 0.15
82 0.15
83 0.24
84 0.28
85 0.35
86 0.43
87 0.52
88 0.58
89 0.68
90 0.76
91 0.78
92 0.82
93 0.84
94 0.78
95 0.72
96 0.68