Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9JXT4

Protein Details
Accession A0A5M9JXT4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
96-128TTPNPNPNTQTRKQKNNNKTRKTQPATRNTQHAHydrophilic
NLS Segment(s)
Subcellular Location(s) E.R. 2, cyto_mito 2, extr 5, mito 4, mito_nucl 2, plas 14
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYGVSVCGLDGGGSCVVLGCVVLCCVYLFTRLMCGLDWIGLESGVFVFVFEFVSVFEFICSFECVFEYPWTRICIRTQPCHAIPPNPHRNIVKSPTTPNPNPNTQTRKQKNNNKTRKTQPATRNTQHA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.06
5 0.06
6 0.04
7 0.04
8 0.04
9 0.05
10 0.05
11 0.05
12 0.06
13 0.07
14 0.09
15 0.09
16 0.09
17 0.12
18 0.12
19 0.12
20 0.11
21 0.12
22 0.1
23 0.1
24 0.1
25 0.08
26 0.08
27 0.07
28 0.07
29 0.05
30 0.05
31 0.05
32 0.04
33 0.03
34 0.03
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.05
41 0.06
42 0.06
43 0.05
44 0.05
45 0.06
46 0.07
47 0.08
48 0.06
49 0.06
50 0.06
51 0.07
52 0.08
53 0.1
54 0.12
55 0.12
56 0.14
57 0.17
58 0.17
59 0.18
60 0.19
61 0.25
62 0.27
63 0.32
64 0.34
65 0.38
66 0.39
67 0.44
68 0.43
69 0.4
70 0.43
71 0.47
72 0.53
73 0.49
74 0.52
75 0.47
76 0.5
77 0.51
78 0.5
79 0.47
80 0.4
81 0.43
82 0.48
83 0.54
84 0.53
85 0.55
86 0.54
87 0.54
88 0.54
89 0.58
90 0.58
91 0.58
92 0.66
93 0.66
94 0.72
95 0.75
96 0.82
97 0.84
98 0.87
99 0.9
100 0.88
101 0.89
102 0.88
103 0.89
104 0.86
105 0.85
106 0.84
107 0.83
108 0.85