Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9JLX9

Protein Details
Accession A0A5M9JLX9    Localization Confidence Low Confidence Score 5.3
NoLS Segment(s)
PositionSequenceProtein Nature
588-611ASIHRLARPRSERNKRKLQGTFCAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 23, nucl 1, mito 1, cyto 1, cyto_nucl 1, E.R. 1, cyto_mito 1, mito_nucl 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR013320  ConA-like_dom_sf  
IPR001722  Glyco_hydro_7  
IPR037019  Glyco_hydro_7_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0004553  F:hydrolase activity, hydrolyzing O-glycosyl compounds  
GO:0030245  P:cellulose catabolic process  
Pfam View protein in Pfam  
PF00840  Glyco_hydro_7  
CDD cd07999  GH7_CBH_EG  
Amino Acid Sequences MYSAAVLATFSFLLGAGAQQVGTLNAENHPALTIQKCASGGTCTDENDSIVLDANWRWLHSTSGSTNCYTGNTWDATLCPDAATCTANCALDGADYAGTYGITSSGDSLKLSFVTGSNVGSRTYLMDSETTYKEFALLGNEFTFTVDVSKLPCGLNGALYFVPMDKDGGMSKYPTNKAGAKYGTGYCDAQCPQDMKFVNGTANNVGWKPDSNSANSGTGNIGSCCSEFDVWEANSMSQALTPHVCTTEGQTSCTGDDCTANTGVCDADGLERPLTPPRSSALLPNSSLMTEPKPELSPRSKRFYVQGDVVFEQPNSDISGVSGNSITDDFCSAQKTAFGDVDYFTKKGGMAAMGKKMAAGMVLVLSIWDDYNVNMLWLDSAYPASKDATAPGVARGSCAATSGAPADVEAASGSAYVTFSGIKYGPIGSTFKAPSSVALPSPVAAVVSVASSSAPASSAPASSAPVASALQLHPPQLPLLQLHLPQLHLLQLHLPQLPLPQLPLPQLHPAPPPRRSAPRSAHPAPSRPPSPPQPSSLPPPLPQPPPPPLDPFPFTATAPVARPAPRANVSSKTHSTPNVSPHNWAHVASIHRLARPRSERNKRKLQGTFCAMLGLDCGVYLHVLYILAIVVYRLDPQDHQRRKFT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.07
5 0.06
6 0.07
7 0.07
8 0.07
9 0.09
10 0.1
11 0.1
12 0.11
13 0.14
14 0.14
15 0.14
16 0.14
17 0.13
18 0.16
19 0.16
20 0.2
21 0.17
22 0.2
23 0.21
24 0.21
25 0.21
26 0.2
27 0.19
28 0.21
29 0.22
30 0.21
31 0.24
32 0.24
33 0.23
34 0.2
35 0.2
36 0.14
37 0.13
38 0.11
39 0.11
40 0.1
41 0.16
42 0.16
43 0.16
44 0.18
45 0.18
46 0.21
47 0.21
48 0.26
49 0.25
50 0.32
51 0.34
52 0.32
53 0.32
54 0.3
55 0.3
56 0.26
57 0.23
58 0.2
59 0.19
60 0.18
61 0.18
62 0.18
63 0.19
64 0.19
65 0.17
66 0.13
67 0.11
68 0.12
69 0.13
70 0.15
71 0.11
72 0.14
73 0.16
74 0.15
75 0.15
76 0.14
77 0.13
78 0.11
79 0.12
80 0.09
81 0.08
82 0.07
83 0.08
84 0.07
85 0.07
86 0.06
87 0.06
88 0.05
89 0.05
90 0.05
91 0.07
92 0.08
93 0.09
94 0.09
95 0.1
96 0.11
97 0.1
98 0.11
99 0.1
100 0.09
101 0.12
102 0.13
103 0.13
104 0.15
105 0.16
106 0.15
107 0.15
108 0.15
109 0.13
110 0.14
111 0.13
112 0.12
113 0.12
114 0.13
115 0.18
116 0.19
117 0.18
118 0.17
119 0.16
120 0.16
121 0.15
122 0.14
123 0.14
124 0.13
125 0.13
126 0.13
127 0.14
128 0.14
129 0.14
130 0.13
131 0.08
132 0.09
133 0.08
134 0.08
135 0.09
136 0.1
137 0.12
138 0.12
139 0.12
140 0.14
141 0.13
142 0.15
143 0.14
144 0.16
145 0.14
146 0.14
147 0.14
148 0.11
149 0.11
150 0.09
151 0.09
152 0.06
153 0.08
154 0.09
155 0.11
156 0.11
157 0.13
158 0.16
159 0.23
160 0.25
161 0.25
162 0.28
163 0.31
164 0.32
165 0.36
166 0.35
167 0.29
168 0.3
169 0.3
170 0.28
171 0.26
172 0.25
173 0.19
174 0.22
175 0.21
176 0.19
177 0.2
178 0.19
179 0.17
180 0.23
181 0.23
182 0.21
183 0.22
184 0.22
185 0.22
186 0.22
187 0.23
188 0.18
189 0.18
190 0.17
191 0.15
192 0.15
193 0.13
194 0.13
195 0.15
196 0.2
197 0.21
198 0.21
199 0.23
200 0.25
201 0.26
202 0.25
203 0.22
204 0.16
205 0.16
206 0.14
207 0.12
208 0.1
209 0.09
210 0.09
211 0.09
212 0.09
213 0.08
214 0.08
215 0.09
216 0.13
217 0.12
218 0.15
219 0.15
220 0.13
221 0.13
222 0.14
223 0.12
224 0.09
225 0.09
226 0.08
227 0.08
228 0.09
229 0.09
230 0.1
231 0.1
232 0.09
233 0.13
234 0.19
235 0.18
236 0.19
237 0.19
238 0.2
239 0.19
240 0.2
241 0.17
242 0.1
243 0.1
244 0.09
245 0.11
246 0.11
247 0.1
248 0.09
249 0.09
250 0.08
251 0.07
252 0.06
253 0.04
254 0.05
255 0.07
256 0.08
257 0.08
258 0.08
259 0.1
260 0.15
261 0.17
262 0.16
263 0.15
264 0.15
265 0.18
266 0.19
267 0.22
268 0.22
269 0.22
270 0.23
271 0.22
272 0.21
273 0.18
274 0.18
275 0.15
276 0.11
277 0.1
278 0.1
279 0.11
280 0.12
281 0.12
282 0.17
283 0.24
284 0.32
285 0.36
286 0.43
287 0.42
288 0.42
289 0.46
290 0.46
291 0.42
292 0.36
293 0.34
294 0.29
295 0.29
296 0.29
297 0.25
298 0.19
299 0.16
300 0.12
301 0.1
302 0.08
303 0.07
304 0.06
305 0.05
306 0.07
307 0.07
308 0.07
309 0.07
310 0.06
311 0.06
312 0.06
313 0.06
314 0.04
315 0.06
316 0.06
317 0.06
318 0.08
319 0.08
320 0.08
321 0.1
322 0.1
323 0.11
324 0.11
325 0.1
326 0.09
327 0.1
328 0.13
329 0.13
330 0.12
331 0.1
332 0.1
333 0.1
334 0.1
335 0.09
336 0.08
337 0.11
338 0.13
339 0.16
340 0.16
341 0.16
342 0.15
343 0.15
344 0.12
345 0.08
346 0.06
347 0.03
348 0.03
349 0.03
350 0.03
351 0.03
352 0.03
353 0.03
354 0.03
355 0.03
356 0.03
357 0.03
358 0.05
359 0.05
360 0.05
361 0.05
362 0.05
363 0.05
364 0.05
365 0.05
366 0.04
367 0.05
368 0.05
369 0.06
370 0.06
371 0.07
372 0.08
373 0.07
374 0.08
375 0.09
376 0.1
377 0.1
378 0.11
379 0.12
380 0.12
381 0.12
382 0.11
383 0.11
384 0.09
385 0.1
386 0.09
387 0.06
388 0.07
389 0.08
390 0.07
391 0.06
392 0.06
393 0.06
394 0.06
395 0.06
396 0.05
397 0.04
398 0.04
399 0.04
400 0.04
401 0.03
402 0.04
403 0.04
404 0.04
405 0.04
406 0.04
407 0.07
408 0.07
409 0.07
410 0.08
411 0.08
412 0.08
413 0.1
414 0.12
415 0.1
416 0.15
417 0.15
418 0.15
419 0.16
420 0.16
421 0.15
422 0.15
423 0.16
424 0.12
425 0.13
426 0.13
427 0.11
428 0.12
429 0.11
430 0.08
431 0.06
432 0.06
433 0.04
434 0.04
435 0.04
436 0.04
437 0.04
438 0.04
439 0.04
440 0.04
441 0.04
442 0.04
443 0.06
444 0.07
445 0.07
446 0.08
447 0.08
448 0.09
449 0.1
450 0.1
451 0.08
452 0.09
453 0.08
454 0.08
455 0.09
456 0.08
457 0.13
458 0.14
459 0.15
460 0.15
461 0.15
462 0.16
463 0.15
464 0.16
465 0.11
466 0.14
467 0.16
468 0.17
469 0.2
470 0.2
471 0.2
472 0.19
473 0.18
474 0.16
475 0.13
476 0.13
477 0.12
478 0.13
479 0.16
480 0.16
481 0.16
482 0.14
483 0.16
484 0.18
485 0.16
486 0.15
487 0.14
488 0.15
489 0.18
490 0.19
491 0.2
492 0.24
493 0.25
494 0.26
495 0.31
496 0.38
497 0.43
498 0.45
499 0.49
500 0.49
501 0.58
502 0.59
503 0.62
504 0.61
505 0.63
506 0.68
507 0.66
508 0.69
509 0.64
510 0.67
511 0.63
512 0.63
513 0.57
514 0.51
515 0.54
516 0.54
517 0.58
518 0.54
519 0.54
520 0.52
521 0.53
522 0.57
523 0.59
524 0.53
525 0.45
526 0.49
527 0.5
528 0.49
529 0.51
530 0.5
531 0.47
532 0.49
533 0.5
534 0.5
535 0.48
536 0.49
537 0.46
538 0.43
539 0.41
540 0.38
541 0.35
542 0.3
543 0.28
544 0.24
545 0.23
546 0.23
547 0.22
548 0.22
549 0.25
550 0.25
551 0.3
552 0.32
553 0.34
554 0.35
555 0.4
556 0.43
557 0.48
558 0.49
559 0.46
560 0.47
561 0.47
562 0.49
563 0.46
564 0.49
565 0.51
566 0.48
567 0.5
568 0.48
569 0.52
570 0.47
571 0.42
572 0.36
573 0.31
574 0.33
575 0.31
576 0.37
577 0.32
578 0.34
579 0.39
580 0.39
581 0.44
582 0.5
583 0.57
584 0.6
585 0.69
586 0.76
587 0.8
588 0.89
589 0.85
590 0.86
591 0.84
592 0.8
593 0.79
594 0.75
595 0.68
596 0.57
597 0.52
598 0.42
599 0.34
600 0.27
601 0.18
602 0.1
603 0.08
604 0.08
605 0.06
606 0.06
607 0.06
608 0.06
609 0.06
610 0.06
611 0.06
612 0.06
613 0.06
614 0.05
615 0.05
616 0.05
617 0.06
618 0.06
619 0.08
620 0.09
621 0.12
622 0.15
623 0.25
624 0.36
625 0.45