Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M9JL01

Protein Details
Accession A0A5M9JL01    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
12-38GSHWINILGPRRRRRRRTILFNSNANYHydrophilic
NLS Segment(s)
PositionSequence
21-28PRRRRRRR
Subcellular Location(s) nucl 18, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR012882  Fmp46  
IPR036249  Thioredoxin-like_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF07955  DUF1687  
Amino Acid Sequences MFSNSLRFKCYGSHWINILGPRRRRRRRTILFNSNANYSHKLQSSINMFRFHKTLDVVTLFHKASSPASLRVHTLLKQASAHAAATATEDQASDHSAQTHPRRQEFQLEVTESAPTPDQLKSILEYIGVSKVGSLVTGAKDEADAVRKIKSNDDSFQRPLTVDWSNGKAVAGDNESEILKMLNDISKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.4
3 0.42
4 0.44
5 0.47
6 0.46
7 0.51
8 0.57
9 0.66
10 0.73
11 0.79
12 0.84
13 0.86
14 0.88
15 0.9
16 0.91
17 0.91
18 0.87
19 0.84
20 0.76
21 0.68
22 0.59
23 0.51
24 0.45
25 0.37
26 0.35
27 0.3
28 0.31
29 0.28
30 0.31
31 0.35
32 0.38
33 0.39
34 0.4
35 0.4
36 0.39
37 0.39
38 0.34
39 0.3
40 0.24
41 0.2
42 0.17
43 0.18
44 0.17
45 0.17
46 0.2
47 0.18
48 0.16
49 0.16
50 0.13
51 0.12
52 0.16
53 0.16
54 0.18
55 0.19
56 0.2
57 0.21
58 0.22
59 0.23
60 0.21
61 0.22
62 0.18
63 0.17
64 0.17
65 0.16
66 0.15
67 0.14
68 0.12
69 0.09
70 0.08
71 0.07
72 0.08
73 0.08
74 0.07
75 0.06
76 0.06
77 0.06
78 0.06
79 0.08
80 0.07
81 0.06
82 0.08
83 0.08
84 0.14
85 0.19
86 0.25
87 0.27
88 0.29
89 0.32
90 0.32
91 0.39
92 0.36
93 0.34
94 0.32
95 0.3
96 0.28
97 0.26
98 0.25
99 0.17
100 0.16
101 0.12
102 0.08
103 0.09
104 0.08
105 0.08
106 0.09
107 0.09
108 0.1
109 0.11
110 0.1
111 0.09
112 0.09
113 0.09
114 0.1
115 0.09
116 0.08
117 0.07
118 0.07
119 0.07
120 0.06
121 0.06
122 0.06
123 0.07
124 0.08
125 0.08
126 0.07
127 0.08
128 0.08
129 0.09
130 0.12
131 0.13
132 0.13
133 0.16
134 0.2
135 0.21
136 0.27
137 0.32
138 0.33
139 0.38
140 0.44
141 0.46
142 0.46
143 0.47
144 0.42
145 0.36
146 0.31
147 0.3
148 0.26
149 0.23
150 0.24
151 0.25
152 0.25
153 0.25
154 0.24
155 0.2
156 0.19
157 0.19
158 0.17
159 0.14
160 0.14
161 0.15
162 0.15
163 0.15
164 0.14
165 0.1
166 0.08
167 0.08
168 0.1