Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9K3L1

Protein Details
Accession A0A5M9K3L1   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
6-33EPSSEAYRERKAKKQRSQPQPQGQQLQTHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 7, mito 6.5, mito_nucl 9.5, nucl 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027843  DUF4440  
Pfam View protein in Pfam  
PF14534  DUF4440  
Amino Acid Sequences MSFILEPSSEAYRERKAKKQRSQPQPQGQQLQTQSPASPPNTPPSMSMQQQQQNGGQLAHNFQPQFKQAQQPDTKKPRYKGGNYGPGTISQRIEKAMYDLEHQTWRCRLDKPSALLEYIDPKAVFASPEYGILTNDSEPTLKATLEDDDMRTWNSYEIKDMKIVEVSMMAATVVYDVTASITDETGAQKGIYKAYCTSCWKQEASADWKLCTYTEAPHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.49
3 0.57
4 0.67
5 0.75
6 0.82
7 0.84
8 0.86
9 0.91
10 0.92
11 0.92
12 0.91
13 0.89
14 0.86
15 0.77
16 0.73
17 0.65
18 0.59
19 0.51
20 0.43
21 0.36
22 0.3
23 0.34
24 0.28
25 0.31
26 0.28
27 0.31
28 0.32
29 0.33
30 0.32
31 0.34
32 0.37
33 0.34
34 0.36
35 0.38
36 0.41
37 0.42
38 0.43
39 0.37
40 0.36
41 0.34
42 0.31
43 0.25
44 0.2
45 0.2
46 0.2
47 0.22
48 0.18
49 0.17
50 0.19
51 0.2
52 0.23
53 0.23
54 0.29
55 0.28
56 0.38
57 0.45
58 0.49
59 0.57
60 0.63
61 0.69
62 0.67
63 0.67
64 0.67
65 0.67
66 0.65
67 0.65
68 0.64
69 0.65
70 0.6
71 0.6
72 0.51
73 0.46
74 0.44
75 0.36
76 0.28
77 0.19
78 0.18
79 0.16
80 0.16
81 0.13
82 0.11
83 0.12
84 0.11
85 0.13
86 0.13
87 0.14
88 0.18
89 0.18
90 0.19
91 0.19
92 0.21
93 0.21
94 0.22
95 0.24
96 0.26
97 0.3
98 0.31
99 0.34
100 0.32
101 0.3
102 0.28
103 0.25
104 0.22
105 0.18
106 0.16
107 0.11
108 0.1
109 0.1
110 0.1
111 0.1
112 0.07
113 0.09
114 0.08
115 0.09
116 0.1
117 0.1
118 0.1
119 0.1
120 0.11
121 0.08
122 0.09
123 0.08
124 0.08
125 0.08
126 0.1
127 0.1
128 0.09
129 0.09
130 0.09
131 0.1
132 0.12
133 0.13
134 0.12
135 0.13
136 0.14
137 0.14
138 0.14
139 0.13
140 0.14
141 0.15
142 0.14
143 0.18
144 0.21
145 0.21
146 0.23
147 0.23
148 0.21
149 0.2
150 0.19
151 0.14
152 0.12
153 0.11
154 0.08
155 0.07
156 0.06
157 0.04
158 0.04
159 0.04
160 0.04
161 0.03
162 0.03
163 0.03
164 0.04
165 0.04
166 0.05
167 0.05
168 0.06
169 0.06
170 0.07
171 0.09
172 0.09
173 0.09
174 0.09
175 0.12
176 0.13
177 0.18
178 0.18
179 0.19
180 0.23
181 0.27
182 0.33
183 0.37
184 0.41
185 0.43
186 0.46
187 0.45
188 0.43
189 0.43
190 0.45
191 0.44
192 0.48
193 0.43
194 0.4
195 0.39
196 0.38
197 0.34
198 0.29
199 0.23