Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9JG36

Protein Details
Accession A0A5M9JG36   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
90-118TTPPTILKGNKKTKKKEPTKNKEIPLKTEHydrophilic
NLS Segment(s)
PositionSequence
97-111KGNKKTKKKEPTKNK
Subcellular Location(s) cyto 4, mito 10, nucl 9, pero 2
Family & Domain DBs
Amino Acid Sequences MKSNSAFELVNTWKLVCVAVAPAAIHDAEIMEISSNLLSPPLHLPFYPWPHSIVLLYKHYIINWDQPWTNHSLPLYLHPYSTDKTLPQSTTPPTILKGNKKTKKKEPTKNKEIPLKTENEVKTTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.13
4 0.11
5 0.09
6 0.09
7 0.1
8 0.09
9 0.09
10 0.1
11 0.09
12 0.08
13 0.07
14 0.06
15 0.05
16 0.05
17 0.05
18 0.04
19 0.04
20 0.05
21 0.05
22 0.05
23 0.04
24 0.05
25 0.05
26 0.06
27 0.1
28 0.11
29 0.12
30 0.12
31 0.16
32 0.21
33 0.27
34 0.3
35 0.27
36 0.27
37 0.27
38 0.27
39 0.24
40 0.21
41 0.19
42 0.17
43 0.17
44 0.16
45 0.16
46 0.15
47 0.17
48 0.15
49 0.17
50 0.16
51 0.17
52 0.16
53 0.16
54 0.18
55 0.22
56 0.21
57 0.17
58 0.16
59 0.16
60 0.15
61 0.19
62 0.22
63 0.17
64 0.16
65 0.16
66 0.19
67 0.18
68 0.2
69 0.17
70 0.14
71 0.18
72 0.22
73 0.22
74 0.21
75 0.25
76 0.25
77 0.28
78 0.29
79 0.26
80 0.24
81 0.3
82 0.35
83 0.4
84 0.47
85 0.54
86 0.61
87 0.69
88 0.76
89 0.79
90 0.84
91 0.86
92 0.86
93 0.87
94 0.89
95 0.91
96 0.91
97 0.89
98 0.88
99 0.81
100 0.78
101 0.72
102 0.66
103 0.59
104 0.58
105 0.51