Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9J692

Protein Details
Accession A0A5M9J692   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
24-53GWKGPGFTKKAEPKQKKAKPEEEKEPAPKEBasic
NLS Segment(s)
PositionSequence
16-50GKDHPGRPGWKGPGFTKKAEPKQKKAKPEEEKEPA
Subcellular Location(s) cyto 6, cyto_mito 5.333, cyto_nucl 10.333, mito 3.5, nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021463  Methyltransf_34  
Pfam View protein in Pfam  
PF11312  Methyltransf_34  
Amino Acid Sequences MGKNGKFGKDYGKVVGKDHPGRPGWKGPGFTKKAEPKQKKAKPEEEKEPAPKESPVPVKLQQILLNIFRDTFSGVIDSDDFRQLLQDVKGALYDRDFNRAFGKEEYLEVYSARWSPSRSLCYASILLDLQEHFGEMLPRDGNLQLEVDSKSETDFPSTNFSRSKTRIVSIGGGAAEIVAFGGFLKLQNTPPVTETTPESADEAMASLHLSDSKQEIELLLVDTASWANVVSKLQTSLTTPPPISKYASAAAKEANSALIRPEDFTAKFLKHDVLAMNRADLGDLFGQKPVLVTLFFTLNELYTASISKTTAFLLEITSLLPSGSLLLVVDSPGSYSETKVGTEEKKYPMKFLLDHTLIETQKSRGKESVPDWVKVHSEDSQWFRLSENLRFPIQLENMRYQVHLYRRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.53
3 0.53
4 0.54
5 0.54
6 0.54
7 0.51
8 0.53
9 0.57
10 0.58
11 0.56
12 0.54
13 0.55
14 0.54
15 0.6
16 0.61
17 0.59
18 0.6
19 0.62
20 0.67
21 0.73
22 0.76
23 0.75
24 0.82
25 0.86
26 0.87
27 0.86
28 0.87
29 0.86
30 0.86
31 0.86
32 0.83
33 0.83
34 0.81
35 0.76
36 0.68
37 0.6
38 0.54
39 0.46
40 0.46
41 0.45
42 0.4
43 0.41
44 0.42
45 0.46
46 0.46
47 0.47
48 0.42
49 0.39
50 0.4
51 0.37
52 0.35
53 0.29
54 0.26
55 0.23
56 0.2
57 0.17
58 0.13
59 0.1
60 0.09
61 0.09
62 0.1
63 0.11
64 0.12
65 0.13
66 0.15
67 0.14
68 0.12
69 0.13
70 0.13
71 0.16
72 0.15
73 0.15
74 0.13
75 0.14
76 0.16
77 0.16
78 0.16
79 0.13
80 0.19
81 0.18
82 0.24
83 0.25
84 0.24
85 0.28
86 0.29
87 0.3
88 0.25
89 0.28
90 0.21
91 0.22
92 0.23
93 0.2
94 0.19
95 0.16
96 0.15
97 0.13
98 0.13
99 0.14
100 0.13
101 0.14
102 0.18
103 0.25
104 0.29
105 0.28
106 0.31
107 0.3
108 0.32
109 0.31
110 0.27
111 0.22
112 0.18
113 0.16
114 0.14
115 0.13
116 0.1
117 0.09
118 0.08
119 0.07
120 0.07
121 0.08
122 0.08
123 0.1
124 0.09
125 0.09
126 0.11
127 0.11
128 0.11
129 0.1
130 0.1
131 0.08
132 0.1
133 0.11
134 0.1
135 0.1
136 0.1
137 0.1
138 0.11
139 0.11
140 0.11
141 0.12
142 0.12
143 0.19
144 0.2
145 0.23
146 0.23
147 0.25
148 0.29
149 0.31
150 0.36
151 0.31
152 0.31
153 0.31
154 0.31
155 0.3
156 0.23
157 0.22
158 0.16
159 0.13
160 0.12
161 0.09
162 0.06
163 0.04
164 0.04
165 0.02
166 0.02
167 0.02
168 0.02
169 0.02
170 0.03
171 0.04
172 0.06
173 0.07
174 0.1
175 0.11
176 0.12
177 0.13
178 0.16
179 0.16
180 0.15
181 0.16
182 0.15
183 0.15
184 0.14
185 0.14
186 0.11
187 0.1
188 0.09
189 0.08
190 0.05
191 0.04
192 0.04
193 0.03
194 0.03
195 0.04
196 0.04
197 0.04
198 0.06
199 0.06
200 0.06
201 0.06
202 0.07
203 0.06
204 0.07
205 0.07
206 0.06
207 0.05
208 0.05
209 0.05
210 0.05
211 0.04
212 0.04
213 0.03
214 0.03
215 0.05
216 0.05
217 0.06
218 0.06
219 0.07
220 0.08
221 0.08
222 0.1
223 0.13
224 0.17
225 0.19
226 0.18
227 0.2
228 0.22
229 0.23
230 0.23
231 0.2
232 0.19
233 0.2
234 0.24
235 0.22
236 0.21
237 0.2
238 0.18
239 0.18
240 0.15
241 0.13
242 0.1
243 0.09
244 0.09
245 0.1
246 0.1
247 0.11
248 0.11
249 0.13
250 0.13
251 0.15
252 0.17
253 0.16
254 0.16
255 0.17
256 0.17
257 0.14
258 0.16
259 0.17
260 0.17
261 0.2
262 0.2
263 0.19
264 0.18
265 0.17
266 0.15
267 0.12
268 0.11
269 0.09
270 0.1
271 0.11
272 0.11
273 0.11
274 0.11
275 0.11
276 0.09
277 0.08
278 0.06
279 0.07
280 0.08
281 0.09
282 0.09
283 0.1
284 0.1
285 0.09
286 0.09
287 0.09
288 0.08
289 0.07
290 0.08
291 0.07
292 0.08
293 0.09
294 0.09
295 0.09
296 0.09
297 0.09
298 0.09
299 0.09
300 0.09
301 0.09
302 0.09
303 0.08
304 0.08
305 0.07
306 0.07
307 0.06
308 0.05
309 0.05
310 0.05
311 0.04
312 0.04
313 0.05
314 0.05
315 0.05
316 0.06
317 0.05
318 0.05
319 0.06
320 0.09
321 0.08
322 0.09
323 0.13
324 0.13
325 0.14
326 0.16
327 0.21
328 0.22
329 0.27
330 0.32
331 0.36
332 0.44
333 0.44
334 0.45
335 0.44
336 0.45
337 0.42
338 0.41
339 0.44
340 0.37
341 0.37
342 0.37
343 0.39
344 0.34
345 0.35
346 0.31
347 0.25
348 0.29
349 0.3
350 0.31
351 0.29
352 0.31
353 0.36
354 0.37
355 0.45
356 0.44
357 0.46
358 0.43
359 0.43
360 0.42
361 0.36
362 0.37
363 0.29
364 0.29
365 0.32
366 0.37
367 0.39
368 0.38
369 0.36
370 0.34
371 0.37
372 0.37
373 0.37
374 0.4
375 0.39
376 0.38
377 0.39
378 0.39
379 0.4
380 0.41
381 0.41
382 0.37
383 0.39
384 0.41
385 0.41
386 0.41
387 0.36
388 0.37