Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M9K1P0

Protein Details
Accession A0A5M9K1P0    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
67-97SWCFLVRQQRRWRRYQGRRYRKRLEDHPCELHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, extr 6, nucl 3, plas 3
Family & Domain DBs
Amino Acid Sequences MKNLKGGVTGGKTNLASLKLSLQLLLLLITCKNRHIGHRSYFSSRRYKSRARSSSPRYRRPTCLPCSWCFLVRQQRRWRRYQGRRYRKRLEDHPCELAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.2
3 0.17
4 0.16
5 0.17
6 0.17
7 0.17
8 0.16
9 0.13
10 0.12
11 0.11
12 0.1
13 0.08
14 0.06
15 0.07
16 0.1
17 0.1
18 0.11
19 0.15
20 0.16
21 0.22
22 0.27
23 0.33
24 0.36
25 0.43
26 0.45
27 0.48
28 0.51
29 0.51
30 0.54
31 0.5
32 0.51
33 0.5
34 0.54
35 0.56
36 0.62
37 0.64
38 0.61
39 0.68
40 0.7
41 0.74
42 0.76
43 0.78
44 0.75
45 0.72
46 0.72
47 0.71
48 0.72
49 0.67
50 0.67
51 0.62
52 0.56
53 0.58
54 0.54
55 0.47
56 0.4
57 0.41
58 0.43
59 0.46
60 0.54
61 0.58
62 0.66
63 0.7
64 0.76
65 0.79
66 0.8
67 0.82
68 0.84
69 0.85
70 0.86
71 0.91
72 0.93
73 0.92
74 0.89
75 0.87
76 0.86
77 0.85
78 0.84
79 0.79