Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9K209

Protein Details
Accession A0A5M9K209    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-35MARHPKGQGQHSKSRQRTKKKSRSTRRTSHGYSTDHydrophilic
NLS Segment(s)
PositionSequence
9-26GQHSKSRQRTKKKSRSTR
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MARHPKGQGQHSKSRQRTKKKSRSTRRTSHGYSTDSSNMDDFQYDNNQYAAVSHEHSSATDRDVPSHSAQDQRTYDSEMILWHESRPVFQEQLVEEAELFENGAIVVEPECIEVDNQSTVLNWGSAEDEDTVDVRWQSFESEVDRPLSADDFYSPPITFGQTGSHFPEFTYPNANFVTDDQSTYSYQATTPYDQSTSTLEDLPGTTQFQYREWEYESRDSIMTVTERMERYNHDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.86
3 0.86
4 0.9
5 0.91
6 0.92
7 0.92
8 0.94
9 0.95
10 0.96
11 0.95
12 0.93
13 0.9
14 0.89
15 0.83
16 0.81
17 0.76
18 0.69
19 0.61
20 0.56
21 0.52
22 0.43
23 0.39
24 0.3
25 0.24
26 0.21
27 0.19
28 0.14
29 0.13
30 0.17
31 0.17
32 0.17
33 0.17
34 0.16
35 0.15
36 0.15
37 0.15
38 0.11
39 0.12
40 0.12
41 0.13
42 0.14
43 0.14
44 0.17
45 0.15
46 0.16
47 0.19
48 0.19
49 0.2
50 0.22
51 0.25
52 0.24
53 0.26
54 0.25
55 0.26
56 0.27
57 0.31
58 0.3
59 0.3
60 0.29
61 0.3
62 0.28
63 0.22
64 0.21
65 0.15
66 0.17
67 0.15
68 0.15
69 0.11
70 0.14
71 0.14
72 0.14
73 0.16
74 0.16
75 0.14
76 0.15
77 0.17
78 0.14
79 0.17
80 0.17
81 0.14
82 0.11
83 0.11
84 0.11
85 0.08
86 0.07
87 0.04
88 0.04
89 0.03
90 0.04
91 0.02
92 0.03
93 0.03
94 0.03
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.05
102 0.05
103 0.05
104 0.05
105 0.05
106 0.05
107 0.06
108 0.05
109 0.04
110 0.05
111 0.05
112 0.05
113 0.06
114 0.06
115 0.06
116 0.06
117 0.06
118 0.06
119 0.06
120 0.07
121 0.06
122 0.06
123 0.06
124 0.06
125 0.07
126 0.08
127 0.11
128 0.12
129 0.13
130 0.14
131 0.14
132 0.14
133 0.13
134 0.13
135 0.1
136 0.08
137 0.09
138 0.09
139 0.1
140 0.12
141 0.11
142 0.11
143 0.11
144 0.12
145 0.11
146 0.11
147 0.14
148 0.14
149 0.16
150 0.2
151 0.21
152 0.19
153 0.19
154 0.23
155 0.21
156 0.2
157 0.24
158 0.2
159 0.22
160 0.22
161 0.23
162 0.18
163 0.17
164 0.21
165 0.16
166 0.16
167 0.15
168 0.16
169 0.17
170 0.17
171 0.17
172 0.12
173 0.12
174 0.15
175 0.17
176 0.18
177 0.2
178 0.21
179 0.21
180 0.21
181 0.22
182 0.2
183 0.2
184 0.19
185 0.18
186 0.16
187 0.16
188 0.16
189 0.17
190 0.16
191 0.14
192 0.13
193 0.15
194 0.17
195 0.18
196 0.22
197 0.23
198 0.25
199 0.27
200 0.31
201 0.33
202 0.37
203 0.38
204 0.36
205 0.33
206 0.3
207 0.27
208 0.25
209 0.22
210 0.17
211 0.16
212 0.2
213 0.21
214 0.22
215 0.24