Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H1VIT2

Protein Details
Accession H1VIT2    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
5-25ADSRIDDKRASKKKSKTTLTAHydrophilic
NLS Segment(s)
PositionSequence
12-19KRASKKKS
Subcellular Location(s) nucl 23.5, cyto_nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039558  TPA1/OFD1_N  
Gene Ontology GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
GO:0008152  P:metabolic process  
Pfam View protein in Pfam  
PF13661  2OG-FeII_Oxy_4  
Amino Acid Sequences MKRKADSRIDDKRASKKKSKTTLTADVAKSRFRKGLFDKNVLDSYTRQYATSSPYKHSVINGLVNDRLLRSVRDEIRENVSFTPKETDIYKIHQSGDLANLDGLDDDALAKLPSLLSLRDAIYSETFRDYVSHITGCGPLSGRKTDMAINVYTPGCYLLCHDDVIGSRKVSYILYLTDPDTPGKPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.76
3 0.75
4 0.78
5 0.81
6 0.82
7 0.8
8 0.78
9 0.8
10 0.77
11 0.75
12 0.67
13 0.64
14 0.58
15 0.56
16 0.5
17 0.44
18 0.42
19 0.35
20 0.41
21 0.41
22 0.5
23 0.51
24 0.55
25 0.54
26 0.54
27 0.55
28 0.48
29 0.42
30 0.32
31 0.3
32 0.29
33 0.27
34 0.22
35 0.21
36 0.22
37 0.26
38 0.32
39 0.3
40 0.27
41 0.31
42 0.32
43 0.32
44 0.31
45 0.29
46 0.24
47 0.27
48 0.25
49 0.22
50 0.21
51 0.21
52 0.2
53 0.16
54 0.15
55 0.11
56 0.1
57 0.12
58 0.18
59 0.2
60 0.24
61 0.27
62 0.27
63 0.32
64 0.33
65 0.31
66 0.26
67 0.27
68 0.23
69 0.21
70 0.23
71 0.17
72 0.17
73 0.16
74 0.19
75 0.17
76 0.21
77 0.24
78 0.22
79 0.22
80 0.21
81 0.21
82 0.17
83 0.18
84 0.14
85 0.11
86 0.09
87 0.08
88 0.07
89 0.07
90 0.06
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.03
98 0.03
99 0.03
100 0.05
101 0.06
102 0.06
103 0.07
104 0.09
105 0.09
106 0.1
107 0.11
108 0.11
109 0.12
110 0.13
111 0.13
112 0.13
113 0.12
114 0.12
115 0.12
116 0.12
117 0.13
118 0.14
119 0.13
120 0.12
121 0.13
122 0.14
123 0.14
124 0.14
125 0.13
126 0.14
127 0.17
128 0.18
129 0.19
130 0.18
131 0.19
132 0.21
133 0.23
134 0.22
135 0.2
136 0.19
137 0.21
138 0.2
139 0.19
140 0.16
141 0.14
142 0.11
143 0.1
144 0.12
145 0.14
146 0.15
147 0.15
148 0.15
149 0.16
150 0.19
151 0.23
152 0.24
153 0.19
154 0.18
155 0.19
156 0.2
157 0.18
158 0.17
159 0.15
160 0.14
161 0.17
162 0.18
163 0.19
164 0.22
165 0.23
166 0.23