Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M9K4Q0

Protein Details
Accession A0A5M9K4Q0    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
59-80LETFKTCWKKHQNDQRTSTKDAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 11.333, cyto 11, nucl 10.5, cyto_pero 6.333, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039870  Coa4-like  
Gene Ontology GO:0005758  C:mitochondrial intermembrane space  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MSDRPENKAPATKIVEEENDDEPDEWDKRIFSTGCAEENSKMTDCYFEKKDWRLCKAELETFKTCWKKHQNDQRTSTKDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.38
3 0.33
4 0.34
5 0.28
6 0.24
7 0.23
8 0.21
9 0.19
10 0.2
11 0.18
12 0.16
13 0.14
14 0.12
15 0.12
16 0.16
17 0.15
18 0.13
19 0.17
20 0.18
21 0.19
22 0.2
23 0.2
24 0.17
25 0.18
26 0.19
27 0.14
28 0.13
29 0.11
30 0.14
31 0.13
32 0.18
33 0.19
34 0.2
35 0.25
36 0.3
37 0.38
38 0.41
39 0.45
40 0.44
41 0.43
42 0.48
43 0.48
44 0.49
45 0.46
46 0.47
47 0.45
48 0.43
49 0.49
50 0.49
51 0.44
52 0.47
53 0.53
54 0.55
55 0.62
56 0.71
57 0.74
58 0.77
59 0.85
60 0.85