Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9JWL4

Protein Details
Accession A0A5M9JWL4    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
97-140MKQPYKSGRKSEKPKKSNTKSKSKSKSKSKKSKKTDGKAGKGSEBasic
NLS Segment(s)
PositionSequence
101-137YKSGRKSEKPKKSNTKSKSKSKSKSKKSKKTDGKAGK
Subcellular Location(s) nucl 16, cyto_nucl 12.833, mito_nucl 8.833, cyto 8.5
Family & Domain DBs
Amino Acid Sequences MVIDEFGNLEDEDLAGPPSSTVTAAPEEETLAPPVYTEADLVGAQELYDSVSKWLSEVQEQQEKLPATADPVLLNKDLAEKTKQLQDIGVELIMKSMKQPYKSGRKSEKPKKSNTKSKSKSKSKSKKSKKTDGKAGKGSEAEEGEPLYREGTPGDMPSQEQIQEAIKKAEAIRASREQKAKEDVKHGEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.07
3 0.07
4 0.07
5 0.07
6 0.08
7 0.08
8 0.07
9 0.09
10 0.11
11 0.12
12 0.13
13 0.12
14 0.14
15 0.14
16 0.15
17 0.15
18 0.13
19 0.12
20 0.11
21 0.12
22 0.11
23 0.1
24 0.09
25 0.07
26 0.08
27 0.08
28 0.08
29 0.08
30 0.06
31 0.06
32 0.06
33 0.05
34 0.05
35 0.06
36 0.06
37 0.07
38 0.08
39 0.08
40 0.08
41 0.11
42 0.1
43 0.13
44 0.17
45 0.22
46 0.27
47 0.28
48 0.28
49 0.31
50 0.3
51 0.27
52 0.23
53 0.18
54 0.14
55 0.16
56 0.16
57 0.11
58 0.12
59 0.13
60 0.13
61 0.13
62 0.1
63 0.11
64 0.12
65 0.13
66 0.14
67 0.14
68 0.15
69 0.2
70 0.21
71 0.18
72 0.18
73 0.16
74 0.15
75 0.14
76 0.13
77 0.08
78 0.07
79 0.07
80 0.06
81 0.06
82 0.05
83 0.1
84 0.12
85 0.14
86 0.18
87 0.25
88 0.36
89 0.41
90 0.49
91 0.53
92 0.6
93 0.69
94 0.76
95 0.8
96 0.75
97 0.81
98 0.83
99 0.84
100 0.85
101 0.82
102 0.83
103 0.8
104 0.84
105 0.85
106 0.84
107 0.84
108 0.85
109 0.88
110 0.88
111 0.91
112 0.91
113 0.92
114 0.9
115 0.91
116 0.91
117 0.89
118 0.89
119 0.87
120 0.84
121 0.81
122 0.73
123 0.65
124 0.56
125 0.47
126 0.39
127 0.31
128 0.23
129 0.16
130 0.15
131 0.12
132 0.12
133 0.12
134 0.1
135 0.08
136 0.08
137 0.08
138 0.1
139 0.11
140 0.11
141 0.13
142 0.13
143 0.13
144 0.15
145 0.17
146 0.15
147 0.14
148 0.14
149 0.17
150 0.2
151 0.22
152 0.22
153 0.21
154 0.23
155 0.23
156 0.27
157 0.26
158 0.25
159 0.3
160 0.37
161 0.42
162 0.47
163 0.53
164 0.51
165 0.52
166 0.58
167 0.59
168 0.55
169 0.59