Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9JCM3

Protein Details
Accession A0A5M9JCM3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
81-101LMPIKNKKSRRWDETFRINKSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, cyto 8, mito_nucl 8
Family & Domain DBs
Amino Acid Sequences MIFRTGAILETKGHRHGYGYGHGYGYGYGYGFDTYSGLLGCMCYAVYAVYTDCTVCTVCTVPLLINRVSDKWDICSLSSLLMPIKNKKSRRWDETFRINKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.27
4 0.28
5 0.31
6 0.31
7 0.29
8 0.27
9 0.27
10 0.25
11 0.21
12 0.18
13 0.11
14 0.07
15 0.06
16 0.06
17 0.07
18 0.06
19 0.06
20 0.06
21 0.05
22 0.06
23 0.05
24 0.05
25 0.04
26 0.04
27 0.04
28 0.04
29 0.03
30 0.03
31 0.03
32 0.03
33 0.03
34 0.04
35 0.04
36 0.04
37 0.05
38 0.05
39 0.04
40 0.05
41 0.05
42 0.05
43 0.06
44 0.06
45 0.06
46 0.06
47 0.07
48 0.07
49 0.09
50 0.12
51 0.12
52 0.13
53 0.15
54 0.15
55 0.17
56 0.19
57 0.17
58 0.17
59 0.2
60 0.19
61 0.18
62 0.2
63 0.18
64 0.17
65 0.17
66 0.14
67 0.13
68 0.16
69 0.19
70 0.24
71 0.34
72 0.41
73 0.47
74 0.55
75 0.64
76 0.7
77 0.75
78 0.77
79 0.77
80 0.78
81 0.84