Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9K6R0

Protein Details
Accession A0A5M9K6R0    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
29-53EKAKLSVNKKERRRKELKKQIVVVGHydrophilic
NLS Segment(s)
PositionSequence
36-47NKKERRRKELKK
Subcellular Location(s) cyto_nucl 12.833, nucl 12.5, cyto 9, mito_nucl 8.832, mito 3.5
Family & Domain DBs
Amino Acid Sequences MPKKSGFMGIKGAPDVIQKSNEHFHEVLEKAKLSVNKKERRRKELKKQIVVVGIMDQTPDGRASEWL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.19
4 0.2
5 0.19
6 0.22
7 0.27
8 0.27
9 0.28
10 0.25
11 0.24
12 0.26
13 0.26
14 0.24
15 0.2
16 0.19
17 0.15
18 0.18
19 0.22
20 0.19
21 0.27
22 0.34
23 0.41
24 0.51
25 0.61
26 0.67
27 0.72
28 0.8
29 0.82
30 0.84
31 0.87
32 0.88
33 0.86
34 0.81
35 0.76
36 0.69
37 0.59
38 0.48
39 0.39
40 0.29
41 0.21
42 0.17
43 0.12
44 0.09
45 0.09
46 0.1
47 0.08