Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M9JFG5

Protein Details
Accession A0A5M9JFG5    Localization Confidence Low Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MIHPRFSKEKTYRRNRPPPPPSRSPFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 2.5, cyto_nucl 2.5, cyto 1.5
Family & Domain DBs
Amino Acid Sequences MIHPRFSKEKTYRRNRPPPPPSRSPFLCLAYIDLQPYYLLLLVALLREIGLCRTQVVPWLSTSMIFIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.88
3 0.9
4 0.9
5 0.89
6 0.86
7 0.86
8 0.78
9 0.75
10 0.69
11 0.62
12 0.56
13 0.48
14 0.41
15 0.31
16 0.3
17 0.25
18 0.23
19 0.19
20 0.14
21 0.12
22 0.1
23 0.1
24 0.07
25 0.05
26 0.04
27 0.03
28 0.04
29 0.04
30 0.04
31 0.04
32 0.03
33 0.03
34 0.03
35 0.04
36 0.05
37 0.06
38 0.07
39 0.08
40 0.1
41 0.1
42 0.17
43 0.19
44 0.18
45 0.18
46 0.21
47 0.19
48 0.19