Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9JDV5

Protein Details
Accession A0A5M9JDV5    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
21-46RYERDRSASPRPTRRNDSPRGGPRRSBasic
NLS Segment(s)
PositionSequence
30-56PRPTRRNDSPRGGPRRSASPDRNGRAD
122-153KARRARPRTPTPGKYFGPPKRDDPRGPPRGGW
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 6.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR035979  RBD_domain_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MTSTMDYENENGTRYEDEAPRYERDRSASPRPTRRNDSPRGGPRRSASPDRNGRADERSGPKNDRGPGPQDDGAVNPGSNLFVTGIHPRLLEEEMITSDQADAAKEGLQGEVIEGRTLSIEKARRARPRTPTPGKYFGPPKRDDPRGPPRGGWGGDRYDDRRRGGGYRYEPYGGGRYGGRDDRDRGYSRRDRDDYNDAPRGIDRYAGPRDGGDRYSRGGDERRGGGYQDRDRYDRGGRDDRPARDPAPAAAYGDQAPRGDAREPYGGGERPAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.24
3 0.23
4 0.26
5 0.31
6 0.34
7 0.37
8 0.39
9 0.41
10 0.38
11 0.39
12 0.43
13 0.45
14 0.51
15 0.56
16 0.62
17 0.69
18 0.75
19 0.79
20 0.8
21 0.83
22 0.83
23 0.81
24 0.81
25 0.8
26 0.82
27 0.82
28 0.77
29 0.71
30 0.65
31 0.65
32 0.64
33 0.63
34 0.59
35 0.6
36 0.66
37 0.65
38 0.66
39 0.59
40 0.55
41 0.5
42 0.47
43 0.45
44 0.41
45 0.43
46 0.44
47 0.46
48 0.48
49 0.49
50 0.5
51 0.47
52 0.45
53 0.44
54 0.43
55 0.45
56 0.41
57 0.36
58 0.32
59 0.28
60 0.26
61 0.22
62 0.17
63 0.11
64 0.1
65 0.09
66 0.08
67 0.08
68 0.06
69 0.06
70 0.08
71 0.11
72 0.13
73 0.13
74 0.13
75 0.13
76 0.14
77 0.15
78 0.13
79 0.1
80 0.09
81 0.09
82 0.1
83 0.1
84 0.08
85 0.07
86 0.08
87 0.07
88 0.07
89 0.06
90 0.06
91 0.07
92 0.07
93 0.07
94 0.06
95 0.06
96 0.06
97 0.06
98 0.08
99 0.07
100 0.06
101 0.06
102 0.06
103 0.06
104 0.06
105 0.06
106 0.09
107 0.12
108 0.16
109 0.24
110 0.3
111 0.38
112 0.44
113 0.5
114 0.54
115 0.61
116 0.67
117 0.69
118 0.69
119 0.68
120 0.69
121 0.63
122 0.59
123 0.59
124 0.54
125 0.52
126 0.47
127 0.48
128 0.48
129 0.53
130 0.5
131 0.5
132 0.55
133 0.55
134 0.54
135 0.47
136 0.44
137 0.43
138 0.41
139 0.34
140 0.27
141 0.21
142 0.22
143 0.24
144 0.25
145 0.27
146 0.3
147 0.29
148 0.28
149 0.28
150 0.29
151 0.3
152 0.34
153 0.32
154 0.31
155 0.32
156 0.31
157 0.3
158 0.29
159 0.28
160 0.2
161 0.16
162 0.14
163 0.13
164 0.16
165 0.19
166 0.19
167 0.19
168 0.22
169 0.24
170 0.3
171 0.32
172 0.31
173 0.37
174 0.42
175 0.44
176 0.51
177 0.5
178 0.48
179 0.5
180 0.56
181 0.52
182 0.53
183 0.53
184 0.44
185 0.42
186 0.4
187 0.36
188 0.27
189 0.25
190 0.18
191 0.19
192 0.22
193 0.23
194 0.22
195 0.21
196 0.23
197 0.23
198 0.24
199 0.21
200 0.19
201 0.2
202 0.22
203 0.22
204 0.23
205 0.26
206 0.28
207 0.29
208 0.3
209 0.31
210 0.29
211 0.3
212 0.32
213 0.36
214 0.39
215 0.42
216 0.43
217 0.43
218 0.44
219 0.47
220 0.48
221 0.45
222 0.46
223 0.47
224 0.46
225 0.54
226 0.6
227 0.6
228 0.58
229 0.56
230 0.49
231 0.45
232 0.44
233 0.37
234 0.34
235 0.3
236 0.28
237 0.24
238 0.25
239 0.22
240 0.23
241 0.22
242 0.18
243 0.18
244 0.17
245 0.19
246 0.2
247 0.2
248 0.22
249 0.25
250 0.25
251 0.27
252 0.32
253 0.31