Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9K5B5

Protein Details
Accession A0A5M9K5B5    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
49-78KGKGKGKGKGKGKTKTRKEKEEEKEREKEKBasic
NLS Segment(s)
PositionSequence
32-78KTKMEMKTKDRERKGKGKGKGKGKGKGKGKTKTRKEKEEEKEREKEK
Subcellular Location(s) nucl 22, mito 5
Family & Domain DBs
Amino Acid Sequences MQAESSRFFEHPGQTILYRGQRRFPRSSSTIKTKMEMKTKDRERKGKGKGKGKGKGKGKGKTKTRKEKEEEKEREKEKMIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.29
4 0.32
5 0.35
6 0.33
7 0.39
8 0.44
9 0.5
10 0.54
11 0.52
12 0.51
13 0.49
14 0.56
15 0.54
16 0.56
17 0.56
18 0.52
19 0.51
20 0.49
21 0.5
22 0.5
23 0.49
24 0.44
25 0.47
26 0.55
27 0.62
28 0.63
29 0.66
30 0.64
31 0.68
32 0.74
33 0.73
34 0.72
35 0.72
36 0.73
37 0.74
38 0.76
39 0.75
40 0.73
41 0.72
42 0.73
43 0.72
44 0.73
45 0.73
46 0.74
47 0.76
48 0.79
49 0.82
50 0.85
51 0.85
52 0.86
53 0.85
54 0.86
55 0.86
56 0.86
57 0.86
58 0.82
59 0.83
60 0.76
61 0.74