Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M9K6K1

Protein Details
Accession A0A5M9K6K1    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MFCLKAKNTKKINSHRWLFNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 3.5, cyto_nucl 3.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004835  Chitin_synth  
IPR004834  Chitin_synth_fun  
Gene Ontology GO:0005886  C:plasma membrane  
GO:0004100  F:chitin synthase activity  
GO:0071555  P:cell wall organization  
GO:0006031  P:chitin biosynthetic process  
Pfam View protein in Pfam  
PF01644  Chitin_synth_1  
Amino Acid Sequences MFCLKAKNTKKINSHRWLFNAFGRLLNPEVCILLDAGTKPGPKSLLSLWEGFYNDKDLGGACGEIHAMLGKGGKKLLNPLVAGQNFEYKISNILDKPLEIPLYFHGDHTLSKILGKKGIEGMNIFKKNMFFGRGQNSLLRTGKPRRVASGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.78
3 0.74
4 0.69
5 0.62
6 0.56
7 0.51
8 0.42
9 0.36
10 0.31
11 0.28
12 0.26
13 0.24
14 0.2
15 0.15
16 0.14
17 0.12
18 0.12
19 0.09
20 0.08
21 0.09
22 0.08
23 0.1
24 0.11
25 0.12
26 0.12
27 0.14
28 0.14
29 0.13
30 0.16
31 0.15
32 0.2
33 0.21
34 0.22
35 0.21
36 0.22
37 0.22
38 0.2
39 0.19
40 0.15
41 0.13
42 0.12
43 0.11
44 0.09
45 0.09
46 0.08
47 0.08
48 0.05
49 0.05
50 0.05
51 0.05
52 0.04
53 0.04
54 0.03
55 0.04
56 0.06
57 0.07
58 0.07
59 0.09
60 0.09
61 0.09
62 0.13
63 0.16
64 0.16
65 0.15
66 0.16
67 0.21
68 0.21
69 0.22
70 0.19
71 0.19
72 0.17
73 0.17
74 0.16
75 0.1
76 0.13
77 0.13
78 0.14
79 0.11
80 0.13
81 0.13
82 0.13
83 0.14
84 0.13
85 0.13
86 0.11
87 0.12
88 0.11
89 0.17
90 0.17
91 0.16
92 0.16
93 0.16
94 0.16
95 0.18
96 0.18
97 0.12
98 0.15
99 0.19
100 0.19
101 0.22
102 0.23
103 0.22
104 0.25
105 0.28
106 0.27
107 0.24
108 0.29
109 0.34
110 0.36
111 0.35
112 0.31
113 0.29
114 0.3
115 0.32
116 0.29
117 0.21
118 0.26
119 0.33
120 0.35
121 0.36
122 0.37
123 0.35
124 0.39
125 0.4
126 0.36
127 0.37
128 0.43
129 0.49
130 0.54
131 0.55