Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9J6S0

Protein Details
Accession A0A5M9J6S0    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
15-37MFEFAGKSRRQRINQRNRTERLSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto 9, mito 1, pero 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR008631  Glycogen_synth  
Gene Ontology GO:0004373  F:glycogen (starch) synthase activity  
GO:0005978  P:glycogen biosynthetic process  
Pfam View protein in Pfam  
PF05693  Glycogen_syn  
Amino Acid Sequences MKGVDDSVNQLTNYMFEFAGKSRRQRINQRNRTERLSDLLDWKRMGMEYVKARQLALRRAYPDSFDGEEEDFIPGVEQKISRPFSVPGSPRDRHEGLSTEDYVAWKLPEEEDPDEYPFPLTLRSKKSQMEPKVHTVVRKAHRNTRLPMGNGLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.12
3 0.1
4 0.12
5 0.14
6 0.22
7 0.26
8 0.3
9 0.38
10 0.47
11 0.55
12 0.64
13 0.73
14 0.75
15 0.81
16 0.86
17 0.86
18 0.82
19 0.79
20 0.71
21 0.62
22 0.55
23 0.49
24 0.4
25 0.39
26 0.39
27 0.37
28 0.33
29 0.31
30 0.28
31 0.23
32 0.22
33 0.16
34 0.18
35 0.2
36 0.24
37 0.27
38 0.26
39 0.26
40 0.28
41 0.3
42 0.31
43 0.3
44 0.29
45 0.29
46 0.32
47 0.33
48 0.32
49 0.28
50 0.25
51 0.21
52 0.18
53 0.17
54 0.14
55 0.14
56 0.12
57 0.11
58 0.08
59 0.07
60 0.06
61 0.05
62 0.05
63 0.05
64 0.05
65 0.06
66 0.13
67 0.15
68 0.15
69 0.16
70 0.17
71 0.2
72 0.26
73 0.27
74 0.27
75 0.33
76 0.34
77 0.34
78 0.4
79 0.37
80 0.33
81 0.33
82 0.29
83 0.25
84 0.28
85 0.26
86 0.21
87 0.2
88 0.19
89 0.17
90 0.15
91 0.11
92 0.08
93 0.08
94 0.08
95 0.11
96 0.15
97 0.17
98 0.19
99 0.21
100 0.24
101 0.23
102 0.22
103 0.2
104 0.16
105 0.14
106 0.16
107 0.19
108 0.23
109 0.3
110 0.35
111 0.39
112 0.43
113 0.52
114 0.56
115 0.6
116 0.63
117 0.61
118 0.64
119 0.67
120 0.65
121 0.59
122 0.55
123 0.56
124 0.56
125 0.6
126 0.59
127 0.6
128 0.68
129 0.72
130 0.71
131 0.72
132 0.7
133 0.63