Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M9JUM2

Protein Details
Accession A0A5M9JUM2    Localization Confidence High Confidence Score 17.7
NoLS Segment(s)
PositionSequenceProtein Nature
5-34MLEDGKKRMMKRERRRRKGKGKGKGKGKGEBasic
37-59GEGNKIKQKKKRIYKDEKEKEGEBasic
NLS Segment(s)
PositionSequence
10-75KKRMMKRERRRRKGKGKGKGKGKGEGEGEGNKIKQKKKRIYKDEKEKEGEVKAGVRKMRSPGGRAR
Subcellular Location(s) nucl 20, mito 6
Family & Domain DBs
Amino Acid Sequences MVVWMLEDGKKRMMKRERRRRKGKGKGKGKGKGEGEGEGNKIKQKKKRIYKDEKEKEGEVKAGVRKMRSPGGRARENKEVESEIGDQRGTQLSENRTRTVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.64
3 0.73
4 0.77
5 0.84
6 0.93
7 0.94
8 0.95
9 0.95
10 0.94
11 0.93
12 0.92
13 0.9
14 0.89
15 0.87
16 0.79
17 0.76
18 0.67
19 0.62
20 0.52
21 0.46
22 0.38
23 0.32
24 0.3
25 0.23
26 0.22
27 0.2
28 0.24
29 0.28
30 0.32
31 0.4
32 0.48
33 0.57
34 0.67
35 0.74
36 0.8
37 0.84
38 0.89
39 0.88
40 0.84
41 0.77
42 0.68
43 0.6
44 0.5
45 0.41
46 0.3
47 0.25
48 0.22
49 0.22
50 0.23
51 0.21
52 0.23
53 0.25
54 0.31
55 0.3
56 0.32
57 0.35
58 0.41
59 0.49
60 0.51
61 0.53
62 0.55
63 0.55
64 0.52
65 0.48
66 0.42
67 0.34
68 0.33
69 0.3
70 0.23
71 0.22
72 0.21
73 0.17
74 0.17
75 0.2
76 0.17
77 0.17
78 0.21
79 0.27
80 0.37
81 0.41