Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9JG79

Protein Details
Accession A0A5M9JG79   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
13-47LALSKSQKYARCPKKKREKKKEKIVKTPKGTKRKFBasic
NLS Segment(s)
PositionSequence
25-46PKKKREKKKEKIVKTPKGTKRK
Subcellular Location(s) cyto_nucl 11.5, mito 6, nucl 19
Family & Domain DBs
Amino Acid Sequences MPETPIVESASQLALSKSQKYARCPKKKREKKKEKIVKTPKGTKRKFINNTMPNATLSFPASAATSTIATTRMGNLMIVNTPLQNM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.18
4 0.22
5 0.27
6 0.32
7 0.38
8 0.49
9 0.55
10 0.64
11 0.7
12 0.76
13 0.81
14 0.87
15 0.91
16 0.92
17 0.93
18 0.92
19 0.95
20 0.95
21 0.92
22 0.93
23 0.92
24 0.9
25 0.87
26 0.86
27 0.84
28 0.84
29 0.77
30 0.73
31 0.7
32 0.71
33 0.69
34 0.67
35 0.68
36 0.63
37 0.66
38 0.61
39 0.54
40 0.45
41 0.4
42 0.32
43 0.22
44 0.18
45 0.13
46 0.1
47 0.09
48 0.09
49 0.08
50 0.08
51 0.08
52 0.08
53 0.08
54 0.08
55 0.09
56 0.09
57 0.1
58 0.1
59 0.11
60 0.1
61 0.1
62 0.1
63 0.11
64 0.11
65 0.13
66 0.12