Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9JD60

Protein Details
Accession A0A5M9JD60    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
75-94KSSPVSSKHLKKFRVNCHATHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, cyto_mito 11, cyto 3.5, plas 2, extr 2, pero 2
Family & Domain DBs
Amino Acid Sequences MSGFRLLCVALKHMEMFGLVNFANAWLCNIFLRRLAFKAVAPRSSAAVECGQWSTRHGSMPQVDHVGLVSVCTLKSSPVSSKHLKKFRVNCHAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.12
4 0.09
5 0.1
6 0.08
7 0.08
8 0.08
9 0.08
10 0.08
11 0.07
12 0.08
13 0.06
14 0.07
15 0.08
16 0.09
17 0.1
18 0.12
19 0.14
20 0.15
21 0.16
22 0.18
23 0.17
24 0.18
25 0.25
26 0.25
27 0.25
28 0.24
29 0.24
30 0.22
31 0.22
32 0.21
33 0.14
34 0.12
35 0.11
36 0.1
37 0.11
38 0.1
39 0.1
40 0.11
41 0.13
42 0.13
43 0.15
44 0.15
45 0.18
46 0.21
47 0.23
48 0.24
49 0.22
50 0.2
51 0.19
52 0.18
53 0.15
54 0.11
55 0.09
56 0.08
57 0.06
58 0.06
59 0.07
60 0.07
61 0.07
62 0.09
63 0.13
64 0.17
65 0.23
66 0.3
67 0.39
68 0.48
69 0.58
70 0.64
71 0.68
72 0.73
73 0.76
74 0.8