Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9K3Q0

Protein Details
Accession A0A5M9K3Q0   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
67-104IPITPQHKKPRQSQREKSKESKAKARNQHRKTSGRRKEBasic
NLS Segment(s)
PositionSequence
73-130HKKPRQSQREKSKESKAKARNQHRKTSGRRKEVRGEKREERGERREEKGNVLRGKRGE
Subcellular Location(s) cyto_nucl 15, mito 5, nucl 18
Family & Domain DBs
Amino Acid Sequences MPSPFLPPTNPIPIPSHPIPSHPIPIPIPIPIPIPIPIPIPIPIPIPIPIPIPPSPSPIPSPPSQPIPITPQHKKPRQSQREKSKESKAKARNQHRKTSGRRKEVRGEKREERGERREEKGNVLRGKRGERHVNTNQATYQVFIHHLSTQYLCISLILMRARA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.41
3 0.43
4 0.35
5 0.38
6 0.4
7 0.39
8 0.42
9 0.35
10 0.37
11 0.3
12 0.33
13 0.31
14 0.27
15 0.25
16 0.2
17 0.21
18 0.17
19 0.18
20 0.15
21 0.16
22 0.16
23 0.16
24 0.16
25 0.16
26 0.16
27 0.16
28 0.16
29 0.16
30 0.16
31 0.16
32 0.16
33 0.16
34 0.16
35 0.16
36 0.16
37 0.19
38 0.19
39 0.23
40 0.22
41 0.26
42 0.26
43 0.27
44 0.29
45 0.27
46 0.3
47 0.25
48 0.3
49 0.26
50 0.29
51 0.29
52 0.26
53 0.25
54 0.27
55 0.32
56 0.34
57 0.35
58 0.41
59 0.49
60 0.55
61 0.58
62 0.63
63 0.68
64 0.72
65 0.78
66 0.78
67 0.8
68 0.84
69 0.85
70 0.81
71 0.79
72 0.76
73 0.69
74 0.69
75 0.66
76 0.65
77 0.68
78 0.74
79 0.74
80 0.73
81 0.78
82 0.76
83 0.77
84 0.79
85 0.8
86 0.79
87 0.78
88 0.8
89 0.76
90 0.78
91 0.79
92 0.79
93 0.75
94 0.74
95 0.7
96 0.71
97 0.73
98 0.7
99 0.67
100 0.64
101 0.65
102 0.62
103 0.6
104 0.6
105 0.53
106 0.55
107 0.55
108 0.55
109 0.54
110 0.51
111 0.51
112 0.48
113 0.54
114 0.52
115 0.52
116 0.54
117 0.52
118 0.59
119 0.61
120 0.66
121 0.61
122 0.58
123 0.51
124 0.44
125 0.4
126 0.32
127 0.26
128 0.18
129 0.18
130 0.17
131 0.18
132 0.17
133 0.18
134 0.2
135 0.2
136 0.2
137 0.18
138 0.17
139 0.15
140 0.13
141 0.12
142 0.11
143 0.15