Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9K3Q0

Protein Details
Accession A0A5M9K3Q0    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
67-104IPITPQHKKPRQSQREKSKESKAKARNQHRKTSGRRKEBasic
NLS Segment(s)
PositionSequence
73-130HKKPRQSQREKSKESKAKARNQHRKTSGRRKEVRGEKREERGERREEKGNVLRGKRGE
Subcellular Location(s) nucl 18, cyto_nucl 15, mito 5
Family & Domain DBs
Amino Acid Sequences MPSPFLPPTNPIPIPSHPIPSHPIPIPIPIPIPIPIPIPIPIPIPIPIPIPIPPSPSPIPSPPSQPIPITPQHKKPRQSQREKSKESKAKARNQHRKTSGRRKEVRGEKREERGERREEKGNVLRGKRGERHVNTNQATYQVFIHHLSTQYLCISLILMRARA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.41
3 0.43
4 0.35
5 0.38
6 0.4
7 0.39
8 0.42
9 0.35
10 0.37
11 0.3
12 0.33
13 0.31
14 0.27
15 0.25
16 0.2
17 0.21
18 0.17
19 0.18
20 0.15
21 0.16
22 0.16
23 0.16
24 0.16
25 0.16
26 0.16
27 0.16
28 0.16
29 0.16
30 0.16
31 0.16
32 0.16
33 0.16
34 0.16
35 0.16
36 0.16
37 0.19
38 0.19
39 0.23
40 0.22
41 0.26
42 0.26
43 0.27
44 0.29
45 0.27
46 0.3
47 0.25
48 0.3
49 0.26
50 0.29
51 0.29
52 0.26
53 0.25
54 0.27
55 0.32
56 0.34
57 0.35
58 0.41
59 0.49
60 0.55
61 0.58
62 0.63
63 0.68
64 0.72
65 0.78
66 0.78
67 0.8
68 0.84
69 0.85
70 0.81
71 0.79
72 0.76
73 0.69
74 0.69
75 0.66
76 0.65
77 0.68
78 0.74
79 0.74
80 0.73
81 0.78
82 0.76
83 0.77
84 0.79
85 0.8
86 0.79
87 0.78
88 0.8
89 0.76
90 0.78
91 0.79
92 0.79
93 0.75
94 0.74
95 0.7
96 0.71
97 0.73
98 0.7
99 0.67
100 0.64
101 0.65
102 0.62
103 0.6
104 0.6
105 0.53
106 0.55
107 0.55
108 0.55
109 0.54
110 0.51
111 0.51
112 0.48
113 0.54
114 0.52
115 0.52
116 0.54
117 0.52
118 0.59
119 0.61
120 0.66
121 0.61
122 0.58
123 0.51
124 0.44
125 0.4
126 0.32
127 0.26
128 0.18
129 0.18
130 0.17
131 0.18
132 0.17
133 0.18
134 0.2
135 0.2
136 0.2
137 0.18
138 0.17
139 0.15
140 0.13
141 0.12
142 0.11
143 0.15