Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9J5C7

Protein Details
Accession A0A5M9J5C7   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
3-25HTQARKHASTQARKKNQNNTPSDHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 4.5, cyto_nucl 10, mito 7, nucl 14.5
Family & Domain DBs
Amino Acid Sequences MEHTQARKHASTQARKKNQNNTPSDGPSVAIDRRFGLAGMPIRRMPISHDAHAVMDGMFEILRLARRRSRDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.78
3 0.83
4 0.85
5 0.83
6 0.81
7 0.76
8 0.72
9 0.67
10 0.6
11 0.54
12 0.44
13 0.37
14 0.28
15 0.26
16 0.2
17 0.16
18 0.13
19 0.12
20 0.13
21 0.12
22 0.11
23 0.08
24 0.1
25 0.14
26 0.15
27 0.17
28 0.16
29 0.17
30 0.18
31 0.18
32 0.18
33 0.22
34 0.25
35 0.25
36 0.26
37 0.26
38 0.27
39 0.27
40 0.23
41 0.14
42 0.09
43 0.07
44 0.06
45 0.05
46 0.04
47 0.05
48 0.05
49 0.12
50 0.15
51 0.21
52 0.26