Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9J6Q5

Protein Details
Accession A0A5M9J6Q5   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
15-40PSSLPNDKTKERKPRKKERGVFLLNLHydrophilic
NLS Segment(s)
PositionSequence
23-33TKERKPRKKER
Subcellular Location(s) cyto_nucl 6, mito 6, nucl 9, plas 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MNDTITIIHYHLPLPSSLPNDKTKERKPRKKERGVFLLNLFHLRSHNLWVWVDKSFFLSFIFLFSHCHCLFLLLFHCLQVGYSLIKTLLADIMYFIRMDRSKLSRCQNLVILFWK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.21
4 0.24
5 0.27
6 0.33
7 0.37
8 0.44
9 0.5
10 0.55
11 0.61
12 0.69
13 0.75
14 0.79
15 0.85
16 0.89
17 0.92
18 0.91
19 0.88
20 0.87
21 0.81
22 0.74
23 0.66
24 0.59
25 0.48
26 0.42
27 0.33
28 0.23
29 0.19
30 0.17
31 0.15
32 0.15
33 0.16
34 0.16
35 0.16
36 0.17
37 0.18
38 0.17
39 0.17
40 0.13
41 0.14
42 0.12
43 0.12
44 0.1
45 0.1
46 0.08
47 0.09
48 0.09
49 0.07
50 0.09
51 0.09
52 0.16
53 0.16
54 0.17
55 0.15
56 0.16
57 0.16
58 0.16
59 0.17
60 0.12
61 0.12
62 0.11
63 0.11
64 0.09
65 0.09
66 0.08
67 0.07
68 0.07
69 0.07
70 0.07
71 0.07
72 0.08
73 0.08
74 0.08
75 0.08
76 0.07
77 0.07
78 0.07
79 0.08
80 0.09
81 0.09
82 0.08
83 0.13
84 0.14
85 0.16
86 0.21
87 0.27
88 0.32
89 0.4
90 0.49
91 0.51
92 0.53
93 0.56
94 0.56
95 0.52