Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9K3L7

Protein Details
Accession A0A5M9K3L7   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
34-59ASAGRPKHNKRVRKERWTRYCKMRVVHydrophilic
NLS Segment(s)
PositionSequence
38-47RPKHNKRVRK
Subcellular Location(s) cyto_nucl 9, mito 9, nucl 12
Family & Domain DBs
Amino Acid Sequences MEINHWKINIHKTSRNFILGIKVEGYQYEAAETASAGRPKHNKRVRKERWTRYCKMRVVSINLGVFQGDPFSRRQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.55
3 0.46
4 0.39
5 0.4
6 0.34
7 0.31
8 0.25
9 0.21
10 0.19
11 0.18
12 0.19
13 0.12
14 0.1
15 0.09
16 0.08
17 0.07
18 0.07
19 0.07
20 0.06
21 0.08
22 0.11
23 0.11
24 0.14
25 0.22
26 0.26
27 0.37
28 0.43
29 0.48
30 0.55
31 0.67
32 0.73
33 0.77
34 0.83
35 0.84
36 0.87
37 0.87
38 0.85
39 0.84
40 0.82
41 0.76
42 0.69
43 0.65
44 0.6
45 0.59
46 0.57
47 0.52
48 0.45
49 0.4
50 0.37
51 0.3
52 0.24
53 0.17
54 0.15
55 0.1
56 0.11