Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M9JLA1

Protein Details
Accession A0A5M9JLA1    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
63-99ARTFRFCRSKCHKNFKMKRNPRKLKWTKAFRKAAGKEHydrophilic
NLS Segment(s)
PositionSequence
77-96FKMKRNPRKLKWTKAFRKAA
Subcellular Location(s) mito 15, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
IPR011017  TRASH_dom  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
CDD cd00472  Ribosomal_L24e_L24  
Amino Acid Sequences MRKVGLPPKFLKFIDIYFISIDNPVQRQGGSENNTATMRIETCYFCSQPCYPSKGITFVRNDARTFRFCRSKCHKNFKMKRNPRKLKWTKAFRKAAGKEMVVDSTLNFSAAATFRPLQP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.31
3 0.27
4 0.22
5 0.22
6 0.19
7 0.17
8 0.17
9 0.14
10 0.14
11 0.14
12 0.13
13 0.13
14 0.13
15 0.15
16 0.22
17 0.23
18 0.24
19 0.23
20 0.25
21 0.25
22 0.24
23 0.23
24 0.17
25 0.13
26 0.11
27 0.13
28 0.11
29 0.15
30 0.18
31 0.17
32 0.16
33 0.2
34 0.2
35 0.23
36 0.26
37 0.27
38 0.24
39 0.27
40 0.27
41 0.29
42 0.3
43 0.31
44 0.3
45 0.28
46 0.34
47 0.33
48 0.32
49 0.29
50 0.31
51 0.29
52 0.3
53 0.32
54 0.35
55 0.34
56 0.43
57 0.48
58 0.56
59 0.62
60 0.7
61 0.73
62 0.75
63 0.84
64 0.85
65 0.88
66 0.88
67 0.89
68 0.9
69 0.92
70 0.88
71 0.9
72 0.89
73 0.88
74 0.87
75 0.88
76 0.87
77 0.87
78 0.87
79 0.81
80 0.82
81 0.74
82 0.72
83 0.66
84 0.57
85 0.49
86 0.43
87 0.38
88 0.29
89 0.26
90 0.18
91 0.16
92 0.15
93 0.13
94 0.11
95 0.1
96 0.12
97 0.12
98 0.13
99 0.15