Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9JIJ3

Protein Details
Accession A0A5M9JIJ3    Localization Confidence Low Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
9-36NKPAQTKATKKYPQQNIKKKTNNANSIHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 5.5, cyto_nucl 5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MIKVKNKGNKPAQTKATKKYPQQNIKKKTNNANSIHKILHLGTVFLLSLHPSIHPSIHPRTINHTHYIKPHHITPCHFIDPSQLVLYGYEYKYDYLNMEIPPLLNSLFITKTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.75
3 0.76
4 0.74
5 0.75
6 0.76
7 0.77
8 0.78
9 0.82
10 0.85
11 0.83
12 0.86
13 0.87
14 0.84
15 0.84
16 0.83
17 0.81
18 0.77
19 0.77
20 0.71
21 0.66
22 0.59
23 0.49
24 0.4
25 0.31
26 0.3
27 0.2
28 0.15
29 0.11
30 0.11
31 0.11
32 0.09
33 0.09
34 0.05
35 0.05
36 0.05
37 0.05
38 0.06
39 0.07
40 0.07
41 0.09
42 0.12
43 0.15
44 0.21
45 0.22
46 0.22
47 0.29
48 0.35
49 0.36
50 0.37
51 0.37
52 0.33
53 0.36
54 0.41
55 0.38
56 0.33
57 0.37
58 0.38
59 0.39
60 0.39
61 0.4
62 0.4
63 0.39
64 0.36
65 0.3
66 0.29
67 0.28
68 0.27
69 0.23
70 0.18
71 0.15
72 0.15
73 0.18
74 0.17
75 0.15
76 0.15
77 0.15
78 0.15
79 0.16
80 0.16
81 0.15
82 0.13
83 0.17
84 0.15
85 0.17
86 0.17
87 0.16
88 0.16
89 0.16
90 0.13
91 0.1
92 0.11
93 0.12