Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9JFC4

Protein Details
Accession A0A5M9JFC4    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
75-107IIGCSLQNKSEKKKKRRRKKRKKRKKKRKKNHTBasic
NLS Segment(s)
PositionSequence
84-106SEKKKKRRRKKRKKRKKKRKKNH
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MVFDILNKEDEMAELIGNDRTRRRKMGEWEDGIRINEAACCPFYQAMNRSITDSVALNRNDSARVCENECKVIMIIGCSLQNKSEKKKKRRRKKRKKRKKKRKKNHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.1
3 0.12
4 0.14
5 0.16
6 0.21
7 0.27
8 0.32
9 0.36
10 0.41
11 0.45
12 0.53
13 0.61
14 0.63
15 0.61
16 0.6
17 0.58
18 0.55
19 0.48
20 0.39
21 0.28
22 0.19
23 0.15
24 0.13
25 0.11
26 0.09
27 0.08
28 0.09
29 0.1
30 0.1
31 0.13
32 0.16
33 0.19
34 0.21
35 0.21
36 0.21
37 0.21
38 0.2
39 0.16
40 0.14
41 0.11
42 0.14
43 0.14
44 0.13
45 0.14
46 0.14
47 0.15
48 0.14
49 0.17
50 0.15
51 0.17
52 0.2
53 0.24
54 0.24
55 0.25
56 0.25
57 0.22
58 0.18
59 0.17
60 0.14
61 0.11
62 0.1
63 0.09
64 0.11
65 0.11
66 0.11
67 0.13
68 0.19
69 0.23
70 0.33
71 0.42
72 0.5
73 0.61
74 0.72
75 0.81
76 0.85
77 0.92
78 0.94
79 0.96
80 0.97
81 0.97
82 0.98
83 0.98
84 0.98
85 0.98
86 0.98
87 0.98