Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9JEI2

Protein Details
Accession A0A5M9JEI2    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
80-108AYQQCPHPKQSLKRRRKVRKTIQSCPTENHydrophilic
NLS Segment(s)
PositionSequence
91-99LKRRRKVRK
Subcellular Location(s) nucl 19, mito 6
Family & Domain DBs
Amino Acid Sequences MCLWGIYTDVSLQFSSSCHCTRHPQIILIQQLSPHTHPEISFINGDNNNKYQHLPCRKEIIMQSFLVITPFHTDPLKRHAYQQCPHPKQSLKRRRKVRKTIQSCPTENTIKHH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.13
3 0.17
4 0.18
5 0.18
6 0.21
7 0.29
8 0.34
9 0.44
10 0.43
11 0.41
12 0.43
13 0.48
14 0.5
15 0.43
16 0.38
17 0.29
18 0.29
19 0.29
20 0.25
21 0.21
22 0.17
23 0.17
24 0.16
25 0.18
26 0.18
27 0.17
28 0.17
29 0.15
30 0.19
31 0.2
32 0.22
33 0.21
34 0.21
35 0.2
36 0.2
37 0.2
38 0.19
39 0.25
40 0.33
41 0.35
42 0.36
43 0.4
44 0.4
45 0.42
46 0.42
47 0.38
48 0.31
49 0.27
50 0.25
51 0.19
52 0.19
53 0.16
54 0.13
55 0.08
56 0.09
57 0.09
58 0.1
59 0.11
60 0.13
61 0.14
62 0.22
63 0.28
64 0.24
65 0.33
66 0.39
67 0.46
68 0.5
69 0.57
70 0.61
71 0.61
72 0.63
73 0.62
74 0.62
75 0.64
76 0.71
77 0.72
78 0.72
79 0.76
80 0.84
81 0.88
82 0.92
83 0.93
84 0.93
85 0.93
86 0.92
87 0.92
88 0.91
89 0.88
90 0.8
91 0.73
92 0.68
93 0.64