Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9JF22

Protein Details
Accession A0A5M9JF22    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
16-35AKPQAARRKPHIRINKPSLSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, cyto_mito 9.5, nucl 7, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MEQTNLFSLFSFHPIAKPQAARRKPHIRINKPSLSLLFFPSLVPSSSRSGPSWRPARPARPARSLQILNPSVLDFAFPPFLNYHLASSTYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.24
3 0.26
4 0.3
5 0.35
6 0.44
7 0.51
8 0.54
9 0.6
10 0.67
11 0.69
12 0.73
13 0.76
14 0.74
15 0.77
16 0.8
17 0.77
18 0.69
19 0.63
20 0.55
21 0.47
22 0.39
23 0.31
24 0.23
25 0.17
26 0.14
27 0.14
28 0.13
29 0.11
30 0.1
31 0.11
32 0.12
33 0.13
34 0.15
35 0.15
36 0.19
37 0.21
38 0.28
39 0.32
40 0.32
41 0.37
42 0.41
43 0.46
44 0.52
45 0.58
46 0.57
47 0.58
48 0.59
49 0.55
50 0.58
51 0.53
52 0.45
53 0.45
54 0.41
55 0.33
56 0.31
57 0.28
58 0.21
59 0.19
60 0.17
61 0.08
62 0.09
63 0.12
64 0.11
65 0.13
66 0.13
67 0.15
68 0.18
69 0.18
70 0.19
71 0.17