Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9K8T9

Protein Details
Accession A0A5M9K8T9    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
43-75STPSPNRKNGRRKASPHRPRRRSQQRTRMFMKTHydrophilic
NLS Segment(s)
PositionSequence
48-65NRKNGRRKASPHRPRRRS
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
Amino Acid Sequences MPACHIVNHGMHVTHFTSEFSHPPPRTFFLSRSSTPSTTTTTSTPSPNRKNGRRKASPHRPRRRSQQRTRMFMKTSQTNLPVSPLGGSSLSQSCEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.14
4 0.15
5 0.17
6 0.19
7 0.2
8 0.28
9 0.28
10 0.3
11 0.33
12 0.34
13 0.38
14 0.38
15 0.36
16 0.34
17 0.38
18 0.37
19 0.4
20 0.41
21 0.35
22 0.35
23 0.35
24 0.31
25 0.27
26 0.27
27 0.22
28 0.21
29 0.22
30 0.24
31 0.28
32 0.33
33 0.36
34 0.43
35 0.5
36 0.56
37 0.64
38 0.69
39 0.72
40 0.72
41 0.75
42 0.78
43 0.81
44 0.82
45 0.83
46 0.86
47 0.84
48 0.82
49 0.86
50 0.86
51 0.86
52 0.87
53 0.86
54 0.85
55 0.85
56 0.84
57 0.79
58 0.71
59 0.65
60 0.61
61 0.57
62 0.51
63 0.49
64 0.46
65 0.4
66 0.38
67 0.36
68 0.29
69 0.23
70 0.19
71 0.15
72 0.14
73 0.13
74 0.13
75 0.13
76 0.15