A0A5M9JP76

UniProt ID: A0A5M9JP76   Organism: Monilinia fructicola
Gene: MED4   Protein: Mediator of RNA polymerase II transcription subunit 4
Length: 130 AA

Protein Details

• Accession: A0A5M9JP76
• Localization Confidence: Medium
• Confidence Score: 14.2
• NoLS Segment(s):

  Position	Sequence	Protein Nature
  58-80	RRGSKNERGRKKKAPTNRKSFNW	Basic

• NLS Segment(s):

  Position	Sequence
  46-75	KKREKAERDREGRRGSKNERGRKKKAPTNR

• Subcellular Location(s): nucl 16, cyto 5, mito 3, pero 2
• Family & Domain DBs:
  • InterPro:
    • IPR019258 Mediator_Med4
  • Gene Ontology:
    • GO:0016592 C:mediator complex
    • GO:0003712 F:transcription coregulator activity
    • GO:0006357 P:regulation of transcription by RNA polymerase II
  • Pfam:
    • PF10018 Med4
• Amino Acid Sequences: MGSDDRPFVPWAREDDIRIGALASIQALVDSGIDPEGWDPELEEQKKREKAERDREGRRGSKNERGRKKKAPTNRKSFNWTSLMTMMTKVYDHDLWTVLNTLHAL

NoLS Predictions per Residue - Data Table

Residue Number, Score
1, 0.3
2, 0.32
3, 0.32
4, 0.29
5, 0.25
6, 0.2
7, 0.15
8, 0.13
9, 0.11
10, 0.07
11, 0.05
12, 0.04
13, 0.04
14, 0.04
15, 0.04
16, 0.04
17, 0.04
18, 0.04
19, 0.04
20, 0.04
21, 0.04
22, 0.05
23, 0.05
24, 0.06
25, 0.05
26, 0.05
27, 0.09
28, 0.16
29, 0.17
30, 0.2
31, 0.21
32, 0.29
33, 0.34
34, 0.35
35, 0.38
36, 0.4
37, 0.49
38, 0.57
39, 0.64
40, 0.64
41, 0.64
42, 0.69
43, 0.69
44, 0.66
45, 0.61
46, 0.58
47, 0.54
48, 0.56
49, 0.61
50, 0.64
51, 0.68
52, 0.72
53, 0.74
54, 0.76
55, 0.8
56, 0.78
57, 0.8
58, 0.81
59, 0.8
60, 0.82
61, 0.83
62, 0.78
63, 0.77
64, 0.73
65, 0.68
66, 0.61
67, 0.52
68, 0.45
69, 0.38
70, 0.34
71, 0.27
72, 0.24
73, 0.19
74, 0.15
75, 0.14
76, 0.11
77, 0.14
78, 0.14
79, 0.15
80, 0.15
81, 0.16
82, 0.15
83, 0.16
84, 0.18
85, 0.13