Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9JIK3

Protein Details
Accession A0A5M9JIK3    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MASKSNPNVPQKKRKVANRAKTQRKNAINKITKNHydrophilic
NLS Segment(s)
PositionSequence
11-35QKKRKVANRAKTQRKNAINKITKNP
Subcellular Location(s) nucl 19, mito 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MASKSNPNVPQKKRKVANRAKTQRKNAINKITKNPRGTRASTVLFPTSGPLAPVSGKKARKLQKAQNCARQRALEKAMKEGEVNMTDAPEGSEETAANGENQGMEVDNIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.85
3 0.86
4 0.87
5 0.88
6 0.89
7 0.9
8 0.9
9 0.9
10 0.88
11 0.87
12 0.86
13 0.83
14 0.83
15 0.81
16 0.77
17 0.78
18 0.79
19 0.76
20 0.74
21 0.69
22 0.66
23 0.63
24 0.6
25 0.55
26 0.5
27 0.45
28 0.39
29 0.37
30 0.3
31 0.25
32 0.21
33 0.17
34 0.13
35 0.11
36 0.09
37 0.07
38 0.07
39 0.08
40 0.09
41 0.12
42 0.18
43 0.19
44 0.22
45 0.3
46 0.37
47 0.45
48 0.52
49 0.57
50 0.6
51 0.69
52 0.72
53 0.75
54 0.73
55 0.68
56 0.64
57 0.59
58 0.52
59 0.48
60 0.48
61 0.43
62 0.37
63 0.38
64 0.37
65 0.33
66 0.31
67 0.25
68 0.22
69 0.19
70 0.19
71 0.14
72 0.13
73 0.12
74 0.12
75 0.11
76 0.08
77 0.08
78 0.07
79 0.08
80 0.07
81 0.09
82 0.1
83 0.09
84 0.09
85 0.09
86 0.08
87 0.07
88 0.08
89 0.07
90 0.07