Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9JZ66

Protein Details
Accession A0A5M9JZ66    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
80-106TYRKQTYRSSITRKKREEKVRESKIVCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 14.666, mito_nucl 10.332, cyto 8
Family & Domain DBs
Amino Acid Sequences MSFFHSKASEWHLIPHHSSTNPPSMLDCLMSQPNIPMTNHMLKAIYIDPACRPIRLCTNHNSSSQEPEVSSHAPPSFKGTYRKQTYRSSITRKKREEKVRESKIVCTNDKRVFAHHLGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.39
3 0.36
4 0.3
5 0.33
6 0.32
7 0.35
8 0.32
9 0.3
10 0.27
11 0.25
12 0.25
13 0.22
14 0.19
15 0.15
16 0.16
17 0.16
18 0.15
19 0.14
20 0.16
21 0.17
22 0.16
23 0.15
24 0.19
25 0.23
26 0.24
27 0.23
28 0.2
29 0.18
30 0.2
31 0.18
32 0.16
33 0.11
34 0.12
35 0.12
36 0.18
37 0.18
38 0.17
39 0.17
40 0.17
41 0.25
42 0.29
43 0.31
44 0.3
45 0.37
46 0.39
47 0.4
48 0.42
49 0.35
50 0.35
51 0.33
52 0.27
53 0.2
54 0.18
55 0.19
56 0.17
57 0.16
58 0.14
59 0.15
60 0.15
61 0.15
62 0.2
63 0.2
64 0.22
65 0.29
66 0.33
67 0.42
68 0.51
69 0.56
70 0.56
71 0.6
72 0.63
73 0.65
74 0.67
75 0.67
76 0.69
77 0.74
78 0.78
79 0.79
80 0.81
81 0.82
82 0.85
83 0.84
84 0.85
85 0.86
86 0.85
87 0.85
88 0.78
89 0.76
90 0.73
91 0.7
92 0.66
93 0.62
94 0.61
95 0.59
96 0.63
97 0.57
98 0.52
99 0.53