Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M9JZU7

Protein Details
Accession A0A5M9JZU7    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
53-78RHPYVQKKRKLLLHPYKKKGKSRANQBasic
NLS Segment(s)
PositionSequence
59-76KKRKLLLHPYKKKGKSRA
Subcellular Location(s) plas 8, E.R. 6, nucl 4, pero 3, mito_nucl 3, mito 2, extr 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MKMNILPTIHPSVRPSMLFLEILLIFLFSSTTSSTNENTPVPHLSSSSSILPRHPYVQKKRKLLLHPYKKKGKSRANQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.28
3 0.23
4 0.23
5 0.21
6 0.19
7 0.17
8 0.13
9 0.13
10 0.11
11 0.09
12 0.07
13 0.06
14 0.07
15 0.04
16 0.05
17 0.05
18 0.07
19 0.08
20 0.1
21 0.11
22 0.12
23 0.14
24 0.13
25 0.13
26 0.14
27 0.14
28 0.13
29 0.12
30 0.12
31 0.11
32 0.12
33 0.14
34 0.16
35 0.18
36 0.17
37 0.19
38 0.22
39 0.23
40 0.27
41 0.31
42 0.38
43 0.46
44 0.55
45 0.62
46 0.66
47 0.71
48 0.73
49 0.75
50 0.77
51 0.77
52 0.79
53 0.81
54 0.82
55 0.86
56 0.86
57 0.87
58 0.87