Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M9J8Y3

Protein Details
Accession A0A5M9J8Y3    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
56-82GTRYRRPDQDKTKKKNKEANKEGKVKKBasic
NLS Segment(s)
PositionSequence
64-91QDKTKKKNKEANKEGKVKKAARKIKATA
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021110  DNA_rep_checkpnt_protein  
Gene Ontology GO:0005634  C:nucleus  
GO:0006260  P:DNA replication  
Pfam View protein in Pfam  
PF11719  Drc1-Sld2  
Amino Acid Sequences MNSHYPSPLETIPETQIDDEVPPPDEEEFPQPDDFLPDGRNLTLILPSEYTASEGGTRYRRPDQDKTKKKNKEANKEGKVKKAARKIKATASGLQNYKRLKLRNTGRKVDLELGAGSEEGSRREVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.21
3 0.2
4 0.16
5 0.16
6 0.14
7 0.14
8 0.14
9 0.13
10 0.13
11 0.14
12 0.14
13 0.15
14 0.18
15 0.19
16 0.2
17 0.2
18 0.19
19 0.18
20 0.2
21 0.19
22 0.15
23 0.13
24 0.12
25 0.13
26 0.13
27 0.13
28 0.1
29 0.1
30 0.11
31 0.1
32 0.1
33 0.09
34 0.1
35 0.1
36 0.09
37 0.1
38 0.08
39 0.08
40 0.08
41 0.08
42 0.11
43 0.14
44 0.15
45 0.18
46 0.23
47 0.28
48 0.33
49 0.41
50 0.49
51 0.57
52 0.67
53 0.72
54 0.77
55 0.79
56 0.81
57 0.81
58 0.79
59 0.79
60 0.79
61 0.81
62 0.79
63 0.81
64 0.77
65 0.75
66 0.74
67 0.69
68 0.66
69 0.65
70 0.65
71 0.62
72 0.67
73 0.63
74 0.63
75 0.65
76 0.6
77 0.56
78 0.53
79 0.52
80 0.49
81 0.48
82 0.47
83 0.4
84 0.43
85 0.43
86 0.42
87 0.39
88 0.46
89 0.53
90 0.58
91 0.65
92 0.67
93 0.65
94 0.64
95 0.64
96 0.59
97 0.5
98 0.41
99 0.33
100 0.26
101 0.22
102 0.18
103 0.15
104 0.12
105 0.11
106 0.1