Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9K4X0

Protein Details
Accession A0A5M9K4X0    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
160-186RVQQLIKPKLQSRKSNRTKKLNDGRNKHydrophilic
NLS Segment(s)
PositionSequence
166-186KPKLQSRKSNRTKKLNDGRNK
Subcellular Location(s) nucl 19, cyto_nucl 12.5, cyto 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018814  DUF5427  
Pfam View protein in Pfam  
PF10310  DUF5427  
Amino Acid Sequences MASKKSKAAPTDDELNELLEGIDEVKVKVPPSKGPSKSHKAKQPSQSEQDLLAELENLGTQQPSRPHTPRIQQVKRSNTATPPPASRRSEDRSSEEKPTLPRKSVDSTRSFHTSFTPSATSSDLQEAEKKAPVAPPATETPSTGGDGHGEVSLQRLQRRRVQQLIKPKLQSRKSNRTKKLNDGRNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.37
3 0.3
4 0.24
5 0.18
6 0.09
7 0.09
8 0.07
9 0.08
10 0.07
11 0.08
12 0.11
13 0.12
14 0.14
15 0.18
16 0.2
17 0.25
18 0.32
19 0.41
20 0.44
21 0.51
22 0.59
23 0.64
24 0.71
25 0.72
26 0.74
27 0.73
28 0.76
29 0.77
30 0.78
31 0.76
32 0.72
33 0.68
34 0.6
35 0.53
36 0.45
37 0.36
38 0.26
39 0.18
40 0.12
41 0.09
42 0.07
43 0.06
44 0.05
45 0.04
46 0.04
47 0.05
48 0.08
49 0.12
50 0.16
51 0.23
52 0.25
53 0.31
54 0.37
55 0.43
56 0.49
57 0.56
58 0.6
59 0.62
60 0.68
61 0.7
62 0.69
63 0.65
64 0.58
65 0.51
66 0.48
67 0.43
68 0.37
69 0.34
70 0.34
71 0.38
72 0.38
73 0.36
74 0.37
75 0.4
76 0.43
77 0.42
78 0.43
79 0.41
80 0.42
81 0.43
82 0.38
83 0.34
84 0.33
85 0.39
86 0.36
87 0.32
88 0.31
89 0.31
90 0.36
91 0.4
92 0.41
93 0.37
94 0.37
95 0.38
96 0.41
97 0.38
98 0.33
99 0.29
100 0.26
101 0.22
102 0.22
103 0.2
104 0.16
105 0.17
106 0.19
107 0.16
108 0.14
109 0.16
110 0.14
111 0.14
112 0.17
113 0.17
114 0.17
115 0.19
116 0.18
117 0.17
118 0.18
119 0.2
120 0.19
121 0.18
122 0.2
123 0.21
124 0.25
125 0.24
126 0.22
127 0.22
128 0.21
129 0.22
130 0.19
131 0.16
132 0.12
133 0.12
134 0.12
135 0.1
136 0.09
137 0.07
138 0.09
139 0.13
140 0.15
141 0.2
142 0.25
143 0.3
144 0.39
145 0.47
146 0.53
147 0.59
148 0.64
149 0.66
150 0.71
151 0.76
152 0.76
153 0.74
154 0.73
155 0.74
156 0.74
157 0.78
158 0.77
159 0.78
160 0.81
161 0.85
162 0.88
163 0.89
164 0.88
165 0.88
166 0.89